BLASTX nr result
ID: Rheum21_contig00028720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00028720 (221 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobr... 68 1e-09 ref|XP_002458719.1| hypothetical protein SORBIDRAFT_03g038940 [S... 66 5e-09 ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citr... 65 7e-09 ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-l... 65 9e-09 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus... 65 9e-09 ref|XP_002315292.2| serine carboxypeptidase S10 family protein [... 65 9e-09 ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27-l... 65 9e-09 ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-l... 65 9e-09 ref|XP_002312024.1| serine carboxypeptidase S10 family protein [... 65 9e-09 ref|XP_006644961.1| PREDICTED: serine carboxypeptidase-like 27-l... 65 1e-08 ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [A... 65 1e-08 ref|XP_004970465.1| PREDICTED: serine carboxypeptidase-like 27-l... 65 1e-08 ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Caps... 65 1e-08 ref|NP_001044713.1| Os01g0833500 [Oryza sativa Japonica Group] g... 65 1e-08 gb|ACR34277.1| unknown [Zea mays] gi|414879854|tpg|DAA56985.1| T... 65 1e-08 ref|NP_001151874.1| LOC100285510 precursor [Zea mays] gi|1956505... 65 1e-08 gb|EAY76388.1| hypothetical protein OsI_04319 [Oryza sativa Indi... 65 1e-08 ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutr... 64 2e-08 gb|ABK24285.1| unknown [Picea sitchensis] 64 2e-08 ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [... 64 2e-08 >gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao] Length = 552 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPTVT WYPW Sbjct: 438 SGDTDAVVPVTATRYSIDALKLPTVTNWYPW 468 >ref|XP_002458719.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor] gi|241930694|gb|EES03839.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor] Length = 467 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPTV WYPW Sbjct: 385 SGDTDAVVPVTATRYSIDALKLPTVVNWYPW 415 >ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina] gi|568865012|ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis] gi|557538467|gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina] Length = 456 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPTV WYPW Sbjct: 375 SGDTDAVVPVTATRYSIDALKLPTVINWYPW 405 >ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum] Length = 456 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTD+VVP+TATRYSIDALKLPT+T WYPW Sbjct: 375 SGDTDSVVPLTATRYSIDALKLPTITNWYPW 405 >gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris] Length = 459 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 377 SGDTDAVVPVTATRYSIDALKLPTIINWYPW 407 >ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa] gi|550330382|gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa] Length = 460 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 376 SGDTDAVVPVTATRYSIDALKLPTIINWYPW 406 >ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum lycopersicum] Length = 456 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTD+VVP+TATRYSIDALKLPT+T WYPW Sbjct: 375 SGDTDSVVPLTATRYSIDALKLPTITNWYPW 405 >ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine max] Length = 460 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 377 SGDTDAVVPVTATRYSIDALKLPTIINWYPW 407 >ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa] gi|222851844|gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa] Length = 460 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 376 SGDTDAVVPVTATRYSIDALKLPTIINWYPW 406 >ref|XP_006644961.1| PREDICTED: serine carboxypeptidase-like 27-like [Oryza brachyantha] Length = 455 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 373 SGDTDAVVPVTATRYSIDALKLPTLVNWYPW 403 >ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda] gi|548854286|gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda] Length = 461 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTD+VVPVTATRYS+DALKLPT+T WYPW Sbjct: 379 SGDTDSVVPVTATRYSLDALKLPTLTNWYPW 409 >ref|XP_004970465.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica] Length = 457 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 375 SGDTDAVVPVTATRYSIDALKLPTLVNWYPW 405 >ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Capsella rubella] gi|482566343|gb|EOA30532.1| hypothetical protein CARUB_v10013654mg [Capsella rubella] Length = 434 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 6/55 (10%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPWL------HWIVLSVLPFCRLHWVV 20 SGDTDAVVPVTATRYS+DALKL T+T WYPW +W +L ++ ++ ++ Sbjct: 380 SGDTDAVVPVTATRYSVDALKLATITNWYPWYDHGKVKNWSILMLISLHKIQKLI 434 >ref|NP_001044713.1| Os01g0833500 [Oryza sativa Japonica Group] gi|56202319|dbj|BAD73778.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group] gi|113534244|dbj|BAF06627.1| Os01g0833500 [Oryza sativa Japonica Group] gi|125572534|gb|EAZ14049.1| hypothetical protein OsJ_03974 [Oryza sativa Japonica Group] gi|215706932|dbj|BAG93392.1| unnamed protein product [Oryza sativa Japonica Group] Length = 454 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 372 SGDTDAVVPVTATRYSIDALKLPTMVNWYPW 402 >gb|ACR34277.1| unknown [Zea mays] gi|414879854|tpg|DAA56985.1| TPA: virulence protein Nf314 [Zea mays] Length = 467 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 385 SGDTDAVVPVTATRYSIDALKLPTLVNWYPW 415 >ref|NP_001151874.1| LOC100285510 precursor [Zea mays] gi|195650519|gb|ACG44727.1| virulence-related protein Nf314 [Zea mays] Length = 467 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 385 SGDTDAVVPVTATRYSIDALKLPTLVNWYPW 415 >gb|EAY76388.1| hypothetical protein OsI_04319 [Oryza sativa Indica Group] Length = 454 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+ WYPW Sbjct: 372 SGDTDAVVPVTATRYSIDALKLPTLVNWYPW 402 >ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum] gi|557108919|gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum] Length = 456 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKL T+T WYPW Sbjct: 374 SGDTDAVVPVTATRYSIDALKLATITNWYPW 404 >gb|ABK24285.1| unknown [Picea sitchensis] Length = 450 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAV+PVT+TRYSI+ALKLPTVTQW+PW Sbjct: 361 SGDTDAVIPVTSTRYSINALKLPTVTQWHPW 391 >ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera] gi|296086044|emb|CBI31485.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 166 SGDTDAVVPVTATRYSIDALKLPTVTQWYPW 74 SGDTDAVVPVTATRYSIDALKLPT+T WY W Sbjct: 375 SGDTDAVVPVTATRYSIDALKLPTITNWYAW 405