BLASTX nr result
ID: Rheum21_contig00028054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00028054 (353 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338053.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_004237999.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_006593024.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 gb|EPS72326.1| hypothetical protein M569_02437, partial [Genlise... 70 3e-10 ref|XP_004309881.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 gb|EMJ07699.1| hypothetical protein PRUPE_ppa019170mg [Prunus pe... 66 1e-09 gb|ESW04178.1| hypothetical protein PHAVU_011G073100g [Phaseolus... 67 2e-09 gb|EOY33083.1| Tetratricopeptide repeat-like superfamily protein... 67 2e-09 ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-09 ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-09 ref|XP_006294242.1| hypothetical protein CARUB_v10023241mg [Caps... 64 2e-08 ref|NP_001154742.1| pentatricopeptide (PPR) repeat-containing pr... 64 2e-08 ref|NP_198082.4| pentatricopeptide (PPR) repeat-containing prote... 64 2e-08 ref|XP_006409790.1| hypothetical protein EUTSA_v10016739mg [Eutr... 64 2e-08 ref|XP_003606459.1| Pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_006424630.1| hypothetical protein CICLE_v10028524mg [Citr... 64 3e-08 emb|CBI16275.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002324476.2| hypothetical protein POPTR_0018s10150g [Popu... 63 5e-08 ref|NP_180348.2| pentatricopeptide repeat-containing protein [Ar... 62 6e-08 gb|AAC73020.1| hypothetical protein [Arabidopsis thaliana] 62 6e-08 >ref|XP_006338053.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565341791|ref|XP_006338054.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 451 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 DE++F A S LPPRFT + L DV+V + DPLVCLELFNWAS++ RF NV + H+ Sbjct: 123 DESQFQNAVSQLPPRFTPEELRDVMVSQRDPLVCLELFNWASKQHRFRHNVSTYHV 178 >ref|XP_004237999.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like isoform 1 [Solanum lycopersicum] gi|460384604|ref|XP_004238000.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 451 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 DE++F A S LPPRFT + L DV+V + DPLVCLELFNWAS++ RF NV + H+ Sbjct: 123 DESQFQNAVSQLPPRFTPEELRDVMVLQRDPLVCLELFNWASKQHRFRHNVSTYHV 178 >ref|XP_006593024.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like, partial [Glycine max] Length = 574 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 D+A+F A S LPPRFT + L +VI R+ DPLVCLELF+WASQ+PRF +V + H+ Sbjct: 182 DQAQFQLALSQLPPRFTPEELCNVIARQNDPLVCLELFHWASQQPRFRHDVSTFHI 237 >gb|EPS72326.1| hypothetical protein M569_02437, partial [Genlisea aurea] Length = 184 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 +E F K S +P RFT + LHDVI +EDPLVCLELFNWAS++ RF NVL+ H+ Sbjct: 36 NEPLFQKVLSQIPARFTNEDLHDVIALQEDPLVCLELFNWASKQHRFRHNVLTFHI 91 >ref|XP_004309881.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 441 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/56 (57%), Positives = 43/56 (76%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 ++A+F K+ S L PRFT + L D+I ++EDPLVCLELFNWASQ+ RF +V S H+ Sbjct: 111 NQAQFQKSVSQLLPRFTPEELGDIITKQEDPLVCLELFNWASQQLRFKHDVNSYHI 166 >gb|EMJ07699.1| hypothetical protein PRUPE_ppa019170mg [Prunus persica] Length = 369 Score = 65.9 bits (159), Expect(2) = 1e-09 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVL 95 DE +F +A S L PRFT + L +VI +++DP+VCLELFNWASQ+PRF + L Sbjct: 75 DEVQFQRAISQLLPRFTPEELCNVITQQDDPIVCLELFNWASQQPRFKHDAL 126 Score = 22.3 bits (46), Expect(2) = 1e-09 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 318 YSSSPSGSSVRAYRKRVNKRLREMK 244 YS+ P R++R+R NKR++ K Sbjct: 50 YSTKPPS---RSFRRRENKRVKSSK 71 >gb|ESW04178.1| hypothetical protein PHAVU_011G073100g [Phaseolus vulgaris] Length = 439 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 D+A+F A S LPPRFT + L VI +++ PLVCLELF+WASQ+PRF +V + H+ Sbjct: 106 DQAQFQLALSQLPPRFTTEELCSVISQQDHPLVCLELFHWASQQPRFRHDVSTYHV 161 >gb|EOY33083.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 429 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 D+ +F KA S L PRFT + L +VI EEDPLVC ELFNWA Q+PRF +V + H+ Sbjct: 107 DQPKFEKAVSQLLPRFTAEELCNVITLEEDPLVCWELFNWAVQQPRFRHDVSTYHI 162 >ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 63.9 bits (154), Expect(2) = 4e-09 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRF 110 DE +F A S +PPRFT + L +VI + DPLVC ELFNWASQ+PRF Sbjct: 103 DETQFQLAVSKIPPRFTSEELCNVISLQRDPLVCFELFNWASQQPRF 149 Score = 22.3 bits (46), Expect(2) = 4e-09 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -3 Query: 288 RAYRKRVNKRLR 253 R++RKR NKRL+ Sbjct: 84 RSFRKRANKRLK 95 >ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 63.9 bits (154), Expect(2) = 4e-09 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRF 110 DE +F A S +PPRFT + L +VI + DPLVC ELFNWASQ+PRF Sbjct: 103 DETQFQLAVSKIPPRFTSEELCNVISLQRDPLVCFELFNWASQQPRF 149 Score = 22.3 bits (46), Expect(2) = 4e-09 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -3 Query: 288 RAYRKRVNKRLR 253 R++RKR NKRL+ Sbjct: 84 RSFRKRANKRLK 95 >ref|XP_006294242.1| hypothetical protein CARUB_v10023241mg [Capsella rubella] gi|482562950|gb|EOA27140.1| hypothetical protein CARUB_v10023241mg [Capsella rubella] Length = 437 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 +E++F + S LPPRFT + L D I EEDP +C LFNWASQ+PRF S H+ Sbjct: 117 NESKFQETISKLPPRFTPEELADAITLEEDPFLCFHLFNWASQQPRFKHENCSYHI 172 >ref|NP_001154742.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] gi|332006287|gb|AED93670.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] Length = 550 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 +E++F + S LPPRFT + L D I EEDP +C LFNWASQ+PRF S H+ Sbjct: 90 NESKFQETISKLPPRFTPEELADAITLEEDPFLCFHLFNWASQQPRFTHENCSYHI 145 >ref|NP_198082.4| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] gi|332006286|gb|AED93669.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] Length = 575 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 +E++F + S LPPRFT + L D I EEDP +C LFNWASQ+PRF S H+ Sbjct: 115 NESKFQETISKLPPRFTPEELADAITLEEDPFLCFHLFNWASQQPRFTHENCSYHI 170 >ref|XP_006409790.1| hypothetical protein EUTSA_v10016739mg [Eutrema salsugineum] gi|557110959|gb|ESQ51243.1| hypothetical protein EUTSA_v10016739mg [Eutrema salsugineum] Length = 407 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEH 86 D+++F + S LPPRFT + L D + +EDPL+C LFNWASQ+PRF S H Sbjct: 87 DQSKFQETISKLPPRFTPEELSDAMTLQEDPLLCFHLFNWASQQPRFKHENCSYH 141 >ref|XP_003606459.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355507514|gb|AES88656.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 418 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 D+ +F A+S L PRFT + L +VI + DPLVCLELF+WAS +PRF N S H+ Sbjct: 80 DQEKFQFAQSQLLPRFTPEELRNVIANQRDPLVCLELFHWASHQPRFRHNESSFHV 135 >ref|XP_006424630.1| hypothetical protein CICLE_v10028524mg [Citrus clementina] gi|568869886|ref|XP_006488146.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Citrus sinensis] gi|557526564|gb|ESR37870.1| hypothetical protein CICLE_v10028524mg [Citrus clementina] Length = 417 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 D+ +F A S LPPRF + L +V+ +EDPLVCLELFNWAS++PRF + + H+ Sbjct: 87 DDTQFRCAVSELPPRFNNEELCNVMTLQEDPLVCLELFNWASKQPRFRHDASTYHI 142 >emb|CBI16275.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/56 (51%), Positives = 43/56 (76%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 +EA+F++A S L PRF+ L +V+ +EDP+VCLE+FNWASQ+PRF +V + H+ Sbjct: 109 NEAQFHQAISELLPRFSAGELCEVLNLQEDPIVCLEIFNWASQQPRFRHDVSTYHI 164 >ref|XP_002324476.2| hypothetical protein POPTR_0018s10150g [Populus trichocarpa] gi|550318443|gb|EEF03041.2| hypothetical protein POPTR_0018s10150g [Populus trichocarpa] Length = 400 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = -2 Query: 250 DEARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 DEA+F ++ S LP RFT + L + I E+DPLVCLELFNWASQ+ RF + + H+ Sbjct: 69 DEAKFQRSVSQLPSRFTNEELCNNITLEDDPLVCLELFNWASQQHRFRHDASTYHV 124 >ref|NP_180348.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546772|sp|Q9ZUY1.2|PP173_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g27800, mitochondrial; Flags: Precursor gi|330252952|gb|AEC08046.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 442 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -2 Query: 244 ARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 ++F++ S LPPRFT + L D I EEDP +C LFNWASQ+PRF S H+ Sbjct: 124 SKFHETISKLPPRFTPEELADAITLEEDPFLCFHLFNWASQQPRFTHENCSYHI 177 >gb|AAC73020.1| hypothetical protein [Arabidopsis thaliana] Length = 427 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -2 Query: 244 ARFNKAKSLLPPRFTVDHLHDVIVREEDPLVCLELFNWASQRPRFMLNVLSEHL 83 ++F++ S LPPRFT + L D I EEDP +C LFNWASQ+PRF S H+ Sbjct: 109 SKFHETISKLPPRFTPEELADAITLEEDPFLCFHLFNWASQQPRFTHENCSYHI 162