BLASTX nr result
ID: Rheum21_contig00027521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00027521 (403 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA94638.1| maturase K, partial [Mercurialis perennis] 56 4e-06 >emb|CCA94638.1| maturase K, partial [Mercurialis perennis] Length = 208 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 139 QLSIQFSI*ESNGVLDVYIGKAVCNENCKHGLGRDFYLIFF 261 QL +F + E N DVYIGKA+CNE CKHGL RDF+ +FF Sbjct: 161 QLPWRFLVWEGNCGFDVYIGKALCNEKCKHGLERDFFYLFF 201