BLASTX nr result
ID: Rheum21_contig00027298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00027298 (1229 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29026.1| hypothetical protein L484_018443 [Morus notabilis] 61 8e-07 ref|XP_004299898.1| PREDICTED: cx9C motif-containing protein 4, ... 60 2e-06 ref|XP_006349347.1| PREDICTED: cx9C motif-containing protein 4-l... 60 2e-06 ref|XP_004230466.1| PREDICTED: cx9C motif-containing protein 4-l... 60 2e-06 dbj|BAK03868.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 2e-06 ref|XP_002529007.1| conserved hypothetical protein [Ricinus comm... 60 2e-06 gb|EOX97159.1| Cox19 family protein (CHCH motif) [Theobroma cacao] 59 5e-06 ref|XP_002442940.1| hypothetical protein SORBIDRAFT_08g005120 [S... 59 5e-06 gb|EPS73449.1| hypothetical protein M569_01308, partial [Genlise... 58 9e-06 >gb|EXB29026.1| hypothetical protein L484_018443 [Morus notabilis] Length = 66 Score = 61.2 bits (147), Expect = 8e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +3 Query: 888 RCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 +C+ VIEKLQ CCE+C Y+STHCASV+GLLKQ++K Sbjct: 30 KCVTVIEKLQFCCEKCNYDSTHCASVAGLLKQISK 64 >ref|XP_004299898.1| PREDICTED: cx9C motif-containing protein 4, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 69 Score = 60.1 bits (144), Expect = 2e-06 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = +3 Query: 852 FLSH*MFVTNWCRCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 FLSH +CL VIE LQ+CCE+C YNSTHCAS+SGLLK K Sbjct: 31 FLSH--------KCLKVIEMLQSCCEKCNYNSTHCASLSGLLKTKPK 69 >ref|XP_006349347.1| PREDICTED: cx9C motif-containing protein 4-like [Solanum tuberosum] Length = 64 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 888 RCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 RC+ VIE L+ CCEQC+Y STHCAS+SGLLKQ+ K Sbjct: 29 RCVKVIEALKYCCEQCEYKSTHCASLSGLLKQIQK 63 >ref|XP_004230466.1| PREDICTED: cx9C motif-containing protein 4-like [Solanum lycopersicum] Length = 64 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 888 RCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 RC+ VIE L+ CCEQC+Y STHCAS+SGLLKQ+ K Sbjct: 29 RCVKVIEALKYCCEQCEYKSTHCASLSGLLKQIQK 63 >dbj|BAK03868.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 70 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 855 LSH*MFVTNWCRCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 LS +F +N +CL VI+ LQ+CCEQC+Y STHC S+SGLLK ++K Sbjct: 20 LSKNLFDSN--KCLKVIQSLQSCCEQCEYKSTHCGSLSGLLKNISK 63 >ref|XP_002529007.1| conserved hypothetical protein [Ricinus communis] gi|223531547|gb|EEF33377.1| conserved hypothetical protein [Ricinus communis] Length = 64 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 888 RCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 RCL VIE LQ+CCE+C+Y STHC SVS LLKQ+ K Sbjct: 29 RCLKVIENLQSCCEKCEYKSTHCGSVSSLLKQIPK 63 >gb|EOX97159.1| Cox19 family protein (CHCH motif) [Theobroma cacao] Length = 63 Score = 58.5 bits (140), Expect = 5e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 888 RCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 RC VIE LQ+CCE+C Y+STHCASVS LLKQ+ K Sbjct: 29 RCRKVIELLQSCCEKCNYDSTHCASVSALLKQIAK 63 >ref|XP_002442940.1| hypothetical protein SORBIDRAFT_08g005120 [Sorghum bicolor] gi|241943633|gb|EES16778.1| hypothetical protein SORBIDRAFT_08g005120 [Sorghum bicolor] Length = 63 Score = 58.5 bits (140), Expect = 5e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +3 Query: 888 RCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 +C+ VI+ LQ+CCEQC+Y STHC SVSGLLK ++K Sbjct: 29 KCVRVIQLLQSCCEQCEYKSTHCGSVSGLLKNISK 63 >gb|EPS73449.1| hypothetical protein M569_01308, partial [Genlisea aurea] Length = 63 Score = 57.8 bits (138), Expect = 9e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 888 RCLHVIEKLQACCEQCKYNSTHCASVSGLLKQLTK 992 +C+ VI+ LQ CCEQC+Y STHCASVS LLKQ+ K Sbjct: 29 KCIKVIQLLQFCCEQCEYKSTHCASVSDLLKQINK 63