BLASTX nr result
ID: Rheum21_contig00026631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00026631 (225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518477.1| ATP synthase gamma chain 2, chloroplast, put... 84 3e-14 ref|XP_005847942.1| hypothetical protein CHLNCDRAFT_145385 [Chlo... 62 4e-14 ref|XP_002305572.1| ATP synthase gamma chain 1 family protein [P... 81 2e-13 ref|XP_003542865.1| PREDICTED: ATP synthase gamma chain, chlorop... 80 3e-13 gb|ESW19721.1| hypothetical protein PHAVU_006G149700g [Phaseolus... 80 4e-13 ref|XP_006290012.1| hypothetical protein CARUB_v10003643mg [Caps... 79 5e-13 ref|NP_567265.1| ATP synthase gamma chain 1 [Arabidopsis thalian... 79 5e-13 ref|XP_002874807.1| hypothetical protein ARALYDRAFT_911722 [Arab... 79 5e-13 emb|CAB52365.1| ATP synthase gamma chain, chloroplast precursor ... 79 5e-13 ref|XP_006396677.1| hypothetical protein EUTSA_v10029134mg [Eutr... 79 6e-13 emb|CBI23241.3| unnamed protein product [Vitis vinifera] 79 6e-13 ref|XP_002275015.1| PREDICTED: ATP synthase gamma chain, chlorop... 79 6e-13 ref|XP_006855900.1| hypothetical protein AMTR_s00037p00168570 [A... 79 8e-13 gb|EOY28705.1| ATPase, F1 complex, gamma subunit protein [Theobr... 79 8e-13 ref|XP_004145113.1| PREDICTED: ATP synthase gamma chain, chlorop... 79 8e-13 ref|XP_004134761.1| PREDICTED: ATP synthase gamma chain, chlorop... 79 8e-13 gb|ADN34052.1| ATP synthase [Cucumis melo subsp. melo] 79 8e-13 gb|EXB50430.1| ATP synthase gamma chain [Morus notabilis] 78 1e-12 gb|EMJ12646.1| hypothetical protein PRUPE_ppa007263mg [Prunus pe... 78 1e-12 ref|XP_003546151.2| PREDICTED: ATP synthase gamma chain, chlorop... 77 2e-12 >ref|XP_002518477.1| ATP synthase gamma chain 2, chloroplast, putative [Ricinus communis] gi|223542322|gb|EEF43864.1| ATP synthase gamma chain 2, chloroplast, putative [Ricinus communis] Length = 376 Score = 83.6 bits (205), Expect = 3e-14 Identities = 44/54 (81%), Positives = 46/54 (85%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQTED+D PLTKNRPVKKVAL G RG Sbjct: 87 AQEAVVNGRPFSETLVEVLYNINEQLQTEDIDVPLTKNRPVKKVALVVVTGDRG 140 >ref|XP_005847942.1| hypothetical protein CHLNCDRAFT_145385 [Chlorella variabilis] gi|307107598|gb|EFN55840.1| hypothetical protein CHLNCDRAFT_145385 [Chlorella variabilis] Length = 239 Score = 62.0 bits (149), Expect(2) = 4e-14 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL 138 AQEAVVN +PF+ LV+VLY +N++L+ EDVD+PL RPVK VAL Sbjct: 67 AQEAVVNGRPFAENLVKVLYGVNQRLRVEDVDSPLVAQRPVKSVAL 112 Score = 41.2 bits (95), Expect(2) = 4e-14 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +2 Query: 137 CVDTAEDEFFRLTTKEGKLTMEKDTVRT 220 CVD A+DE F+LTT+EG+L +E + VRT Sbjct: 122 CVDAADDEVFKLTTREGQLVVEAEQVRT 149 >ref|XP_002305572.1| ATP synthase gamma chain 1 family protein [Populus trichocarpa] gi|118489494|gb|ABK96549.1| unknown [Populus trichocarpa x Populus deltoides] gi|222848536|gb|EEE86083.1| ATP synthase gamma chain 1 family protein [Populus trichocarpa] Length = 375 Score = 80.9 bits (198), Expect = 2e-13 Identities = 44/54 (81%), Positives = 46/54 (85%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQT+DVDAPLTK RPVKKVAL G RG Sbjct: 86 AQEAVVNGRPFSETLVEVLYNINEQLQTDDVDAPLTKVRPVKKVALVVVTGDRG 139 >ref|XP_003542865.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like isoform 3 [Glycine max] Length = 375 Score = 80.1 bits (196), Expect = 3e-13 Identities = 44/54 (81%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQTEDVD PLTK RPVKKVAL G RG Sbjct: 86 AQEAVVNGRPFSETLVEVLYNINEQLQTEDVDIPLTKVRPVKKVALVVITGDRG 139 >gb|ESW19721.1| hypothetical protein PHAVU_006G149700g [Phaseolus vulgaris] gi|561020951|gb|ESW19722.1| hypothetical protein PHAVU_006G149700g [Phaseolus vulgaris] Length = 375 Score = 79.7 bits (195), Expect = 4e-13 Identities = 44/54 (81%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQTEDVD PLTK RPVKKVAL G RG Sbjct: 86 AQEAVVNARPFSETLVEVLYNINEQLQTEDVDIPLTKVRPVKKVALVVCTGDRG 139 >ref|XP_006290012.1| hypothetical protein CARUB_v10003643mg [Capsella rubella] gi|482558718|gb|EOA22910.1| hypothetical protein CARUB_v10003643mg [Capsella rubella] Length = 375 Score = 79.3 bits (194), Expect = 5e-13 Identities = 43/54 (79%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQT+DVD PLTK RPVKKVAL G RG Sbjct: 86 AQEAVVNGRPFSETLVEVLYNINEQLQTDDVDVPLTKVRPVKKVALVVVTGDRG 139 >ref|NP_567265.1| ATP synthase gamma chain 1 [Arabidopsis thaliana] gi|461550|sp|Q01908.1|ATPG1_ARATH RecName: Full=ATP synthase gamma chain 1, chloroplastic; AltName: Full=F-ATPase gamma subunit 1; Flags: Precursor gi|5732056|gb|AAD48955.1|AF149414_4 Arabidopsis thaliana APC1-ATP synthase gamma chain 1 (GB:M61741); contains similarity to Pfam PF00231 -ATP synthase; score=658.6, E=3.1e-194n n+1 [Arabidopsis thaliana] gi|16226524|gb|AAL16191.1|AF428422_1 AT4g04640/T19J18_4 [Arabidopsis thaliana] gi|166632|gb|AAA32753.1| ATP synthase gamma-subunit [Arabidopsis thaliana] gi|7267222|emb|CAB80829.1| AT4g04640 [Arabidopsis thaliana] gi|17473929|gb|AAL38375.1| unknown protein [Arabidopsis thaliana] gi|20148353|gb|AAM10067.1| unknown protein [Arabidopsis thaliana] gi|21594056|gb|AAM65974.1| ATP synthase gamma-subunit, putative [Arabidopsis thaliana] gi|332657008|gb|AEE82408.1| ATP synthase gamma chain 1 [Arabidopsis thaliana] Length = 373 Score = 79.3 bits (194), Expect = 5e-13 Identities = 43/54 (79%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQT+DVD PLTK RPVKKVAL G RG Sbjct: 84 AQEAVVNGRPFSETLVEVLYNINEQLQTDDVDVPLTKVRPVKKVALVVVTGDRG 137 >ref|XP_002874807.1| hypothetical protein ARALYDRAFT_911722 [Arabidopsis lyrata subsp. lyrata] gi|297320644|gb|EFH51066.1| hypothetical protein ARALYDRAFT_911722 [Arabidopsis lyrata subsp. lyrata] Length = 377 Score = 79.3 bits (194), Expect = 5e-13 Identities = 43/54 (79%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQT+DVD PLTK RPVKKVAL G RG Sbjct: 88 AQEAVVNGRPFSETLVEVLYNINEQLQTDDVDVPLTKVRPVKKVALVVVTGDRG 141 >emb|CAB52365.1| ATP synthase gamma chain, chloroplast precursor [Arabidopsis thaliana] Length = 302 Score = 79.3 bits (194), Expect = 5e-13 Identities = 43/54 (79%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQT+DVD PLTK RPVKKVAL G RG Sbjct: 13 AQEAVVNGRPFSETLVEVLYNINEQLQTDDVDVPLTKVRPVKKVALVVVTGDRG 66 >ref|XP_006396677.1| hypothetical protein EUTSA_v10029134mg [Eutrema salsugineum] gi|557097694|gb|ESQ38130.1| hypothetical protein EUTSA_v10029134mg [Eutrema salsugineum] Length = 415 Score = 79.0 bits (193), Expect = 6e-13 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQT+D+D PLTK RPVKKVAL G RG Sbjct: 126 AQEAVVNGRPFSETLVEVLYNINEQLQTDDIDVPLTKVRPVKKVALVVVTGDRG 179 >emb|CBI23241.3| unnamed protein product [Vitis vinifera] Length = 1445 Score = 79.0 bits (193), Expect = 6e-13 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQT+D+D PLTK RPVKKVAL G RG Sbjct: 1285 AQEAVVNGRPFSETLVEVLYNINEQLQTDDIDVPLTKVRPVKKVALVVVTGDRG 1338 >ref|XP_002275015.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like isoform 1 [Vitis vinifera] Length = 372 Score = 79.0 bits (193), Expect = 6e-13 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQT+D+D PLTK RPVKKVAL G RG Sbjct: 83 AQEAVVNGRPFSETLVEVLYNINEQLQTDDIDVPLTKVRPVKKVALVVVTGDRG 136 >ref|XP_006855900.1| hypothetical protein AMTR_s00037p00168570 [Amborella trichopoda] gi|548859721|gb|ERN17367.1| hypothetical protein AMTR_s00037p00168570 [Amborella trichopoda] Length = 354 Score = 78.6 bits (192), Expect = 8e-13 Identities = 43/54 (79%), Positives = 44/54 (81%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQTEDVD PLT RPVKKVAL G RG Sbjct: 65 AQEAVVNGRPFSETLVEVLYNINEQLQTEDVDVPLTNIRPVKKVALVVVTGDRG 118 >gb|EOY28705.1| ATPase, F1 complex, gamma subunit protein [Theobroma cacao] Length = 375 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS +LVEVLYNINEQLQTED+D PLTK RPVKKVAL G RG Sbjct: 86 AQEAVVNGRPFSESLVEVLYNINEQLQTEDIDVPLTKVRPVKKVALVVVTGDRG 139 >ref|XP_004145113.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cucumis sativus] gi|449474626|ref|XP_004154236.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cucumis sativus] gi|449488358|ref|XP_004158011.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cucumis sativus] Length = 373 Score = 78.6 bits (192), Expect = 8e-13 Identities = 43/54 (79%), Positives = 44/54 (81%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS LVEVLYNINEQLQTEDVD PLTK RPVKKVAL G RG Sbjct: 84 AQEAVVNGRPFSEALVEVLYNINEQLQTEDVDVPLTKVRPVKKVALVVVTGDRG 137 >ref|XP_004134761.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cucumis sativus] gi|449479457|ref|XP_004155604.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cucumis sativus] Length = 371 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS +LVEVLYNINEQLQTED+D PLTK RPVKKVAL G RG Sbjct: 82 AQEAVVNGRPFSESLVEVLYNINEQLQTEDIDVPLTKVRPVKKVALIVVTGDRG 135 >gb|ADN34052.1| ATP synthase [Cucumis melo subsp. melo] Length = 373 Score = 78.6 bits (192), Expect = 8e-13 Identities = 43/54 (79%), Positives = 44/54 (81%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS LVEVLYNINEQLQTEDVD PLTK RPVKKVAL G RG Sbjct: 84 AQEAVVNGRPFSEALVEVLYNINEQLQTEDVDVPLTKVRPVKKVALVVVTGDRG 137 >gb|EXB50430.1| ATP synthase gamma chain [Morus notabilis] Length = 375 Score = 78.2 bits (191), Expect = 1e-12 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQTED+D PLT RPVKKVAL G RG Sbjct: 86 AQEAVVNGRPFSETLVEVLYNINEQLQTEDIDVPLTSVRPVKKVALVVVTGDRG 139 >gb|EMJ12646.1| hypothetical protein PRUPE_ppa007263mg [Prunus persica] Length = 376 Score = 77.8 bits (190), Expect = 1e-12 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQLQ ED+DAPLT RPVKKVAL G RG Sbjct: 87 AQEAVVNGRPFSETLVEVLYNINEQLQVEDIDAPLTNVRPVKKVALVVITGDRG 140 >ref|XP_003546151.2| PREDICTED: ATP synthase gamma chain, chloroplastic [Glycine max] Length = 375 Score = 77.4 bits (189), Expect = 2e-12 Identities = 43/54 (79%), Positives = 44/54 (81%), Gaps = 3/54 (5%) Frame = +1 Query: 1 AQEAVVNDKPFS*TLVEVLYNINEQLQTEDVDAPLTKNRPVKKVAL---RGHRG 153 AQEAVVN +PFS TLVEVLYNINEQL TEDVD PLTK RPVKKVAL G RG Sbjct: 86 AQEAVVNGRPFSETLVEVLYNINEQLLTEDVDIPLTKVRPVKKVALVVVTGDRG 139