BLASTX nr result
ID: Rheum21_contig00026278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00026278 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263942.2| PREDICTED: MORC family CW-type zinc finger p... 84 2e-14 emb|CBI37505.3| unnamed protein product [Vitis vinifera] 84 2e-14 gb|EXC26261.1| hypothetical protein L484_022835 [Morus notabilis] 77 3e-12 ref|XP_006467125.1| PREDICTED: MORC family CW-type zinc finger p... 75 7e-12 ref|XP_006467121.1| PREDICTED: MORC family CW-type zinc finger p... 75 7e-12 ref|XP_006425229.1| hypothetical protein CICLE_v10025023mg [Citr... 75 7e-12 ref|XP_006425226.1| hypothetical protein CICLE_v10025023mg [Citr... 75 7e-12 ref|XP_006425225.1| hypothetical protein CICLE_v10025023mg [Citr... 75 7e-12 ref|XP_006425228.1| hypothetical protein CICLE_v10025023mg [Citr... 74 2e-11 ref|XP_006425227.1| hypothetical protein CICLE_v10025023mg [Citr... 74 2e-11 ref|XP_004233760.1| PREDICTED: MORC family CW-type zinc finger p... 74 2e-11 ref|XP_006364836.1| PREDICTED: MORC family CW-type zinc finger p... 74 3e-11 gb|ESW30031.1| hypothetical protein PHAVU_002G118800g [Phaseolus... 70 2e-10 gb|ESW30030.1| hypothetical protein PHAVU_002G118800g [Phaseolus... 70 2e-10 ref|XP_003612418.1| MORC family CW-type zinc finger protein [Med... 68 1e-09 ref|XP_004512434.1| PREDICTED: MORC family CW-type zinc finger p... 66 4e-09 ref|XP_006573514.1| PREDICTED: MORC family CW-type zinc finger p... 66 5e-09 ref|XP_006573513.1| PREDICTED: MORC family CW-type zinc finger p... 66 5e-09 ref|XP_006573512.1| PREDICTED: MORC family CW-type zinc finger p... 66 5e-09 ref|XP_006573511.1| PREDICTED: MORC family CW-type zinc finger p... 66 5e-09 >ref|XP_002263942.2| PREDICTED: MORC family CW-type zinc finger protein 2B-like [Vitis vinifera] Length = 760 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = -3 Query: 166 VFPLDFLVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 +F LVK+ PLA+ + TVIENG++MGK +QL L RCQLEWEQANCGIFLYWH Sbjct: 501 IFIQGSLVKSRPLAKSLNNTVIENGIVMGKPVQLTLGRCQLEWEQANCGIFLYWH 555 >emb|CBI37505.3| unnamed protein product [Vitis vinifera] Length = 596 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = -3 Query: 166 VFPLDFLVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 +F LVK+ PLA+ + TVIENG++MGK +QL L RCQLEWEQANCGIFLYWH Sbjct: 358 IFIQGSLVKSRPLAKSLNNTVIENGIVMGKPVQLTLGRCQLEWEQANCGIFLYWH 412 >gb|EXC26261.1| hypothetical protein L484_022835 [Morus notabilis] Length = 569 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PL +F +KT +E G IMGK +QL L R QLEWEQANCGIFLYWH Sbjct: 437 LVKSRPLEKFLNKTTVETGHIMGKRVQLTLGRSQLEWEQANCGIFLYWH 485 >ref|XP_006467125.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X11 [Citrus sinensis] gi|568825521|ref|XP_006467126.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X12 [Citrus sinensis] Length = 686 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LV++ PLA+ +KT +E G IMGKS L L RCQLEWEQ NCGIFLYWH Sbjct: 438 LVRSRPLAKSLNKTCVETGTIMGKSAHLTLGRCQLEWEQMNCGIFLYWH 486 >ref|XP_006467121.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X7 [Citrus sinensis] Length = 749 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LV++ PLA+ +KT +E G IMGKS L L RCQLEWEQ NCGIFLYWH Sbjct: 506 LVRSRPLAKSLNKTCVETGTIMGKSAHLTLGRCQLEWEQMNCGIFLYWH 554 >ref|XP_006425229.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527219|gb|ESR38469.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] Length = 522 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LV++ PLA+ +KT +E G IMGKS L L RCQLEWEQ NCGIFLYWH Sbjct: 462 LVRSRPLAKSLNKTCVETGTIMGKSAHLTLGRCQLEWEQMNCGIFLYWH 510 >ref|XP_006425226.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865223|ref|XP_006425234.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865233|ref|XP_006425239.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865237|ref|XP_006425241.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865241|ref|XP_006425243.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|568825499|ref|XP_006467115.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X1 [Citrus sinensis] gi|568825501|ref|XP_006467116.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X2 [Citrus sinensis] gi|568825503|ref|XP_006467117.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X3 [Citrus sinensis] gi|568825505|ref|XP_006467118.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X4 [Citrus sinensis] gi|568825507|ref|XP_006467119.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X5 [Citrus sinensis] gi|568825509|ref|XP_006467120.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X6 [Citrus sinensis] gi|557527216|gb|ESR38466.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527224|gb|ESR38474.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527229|gb|ESR38479.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527231|gb|ESR38481.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527233|gb|ESR38483.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] Length = 754 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LV++ PLA+ +KT +E G IMGKS L L RCQLEWEQ NCGIFLYWH Sbjct: 506 LVRSRPLAKSLNKTCVETGTIMGKSAHLTLGRCQLEWEQMNCGIFLYWH 554 >ref|XP_006425225.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865219|ref|XP_006425232.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865221|ref|XP_006425233.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865227|ref|XP_006425236.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865235|ref|XP_006425240.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|568825515|ref|XP_006467123.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X9 [Citrus sinensis] gi|568825517|ref|XP_006467124.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X10 [Citrus sinensis] gi|557527215|gb|ESR38465.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527222|gb|ESR38472.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527223|gb|ESR38473.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527226|gb|ESR38476.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527230|gb|ESR38480.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] Length = 710 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LV++ PLA+ +KT +E G IMGKS L L RCQLEWEQ NCGIFLYWH Sbjct: 462 LVRSRPLAKSLNKTCVETGTIMGKSAHLTLGRCQLEWEQMNCGIFLYWH 510 >ref|XP_006425228.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865215|ref|XP_006425230.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865217|ref|XP_006425231.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865239|ref|XP_006425242.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|568825513|ref|XP_006467122.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like isoform X8 [Citrus sinensis] gi|557527218|gb|ESR38468.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527220|gb|ESR38470.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527221|gb|ESR38471.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527232|gb|ESR38482.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] Length = 726 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = -3 Query: 145 VKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 V++ PLA+ +KT +E G IMGKS L L RCQLEWEQ NCGIFLYWH Sbjct: 479 VRSRPLAKSLNKTCVETGTIMGKSAHLTLGRCQLEWEQMNCGIFLYWH 526 >ref|XP_006425227.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865225|ref|XP_006425235.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865229|ref|XP_006425237.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|567865231|ref|XP_006425238.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527217|gb|ESR38467.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527225|gb|ESR38475.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527227|gb|ESR38477.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] gi|557527228|gb|ESR38478.1| hypothetical protein CICLE_v10025023mg [Citrus clementina] Length = 682 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = -3 Query: 145 VKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 V++ PLA+ +KT +E G IMGKS L L RCQLEWEQ NCGIFLYWH Sbjct: 435 VRSRPLAKSLNKTCVETGTIMGKSAHLTLGRCQLEWEQMNCGIFLYWH 482 >ref|XP_004233760.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Solanum lycopersicum] Length = 707 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -3 Query: 145 VKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 VK+ PLAR ++TV+ENG IMGK +QL L QLEWE+ANCGIFLYWH Sbjct: 455 VKSRPLARSLNRTVVENGTIMGKPVQLTLGCNQLEWEEANCGIFLYWH 502 >ref|XP_006364836.1| PREDICTED: MORC family CW-type zinc finger protein 2B-like [Solanum tuberosum] Length = 707 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -3 Query: 145 VKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 VK+ PLAR ++TV+ENG IMGK +QL L QLEWE+ANCGIFLYWH Sbjct: 455 VKSRPLARSLNRTVVENGTIMGKLVQLTLGCNQLEWEEANCGIFLYWH 502 >gb|ESW30031.1| hypothetical protein PHAVU_002G118800g [Phaseolus vulgaris] Length = 672 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/49 (61%), Positives = 41/49 (83%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PL++F ++TVIE G I+G+ ++LIL QLEWE+ANCG+FLYWH Sbjct: 429 LVKSRPLSKFLTQTVIETGDILGRPVELILGFSQLEWERANCGMFLYWH 477 >gb|ESW30030.1| hypothetical protein PHAVU_002G118800g [Phaseolus vulgaris] Length = 673 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/49 (61%), Positives = 41/49 (83%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PL++F ++TVIE G I+G+ ++LIL QLEWE+ANCG+FLYWH Sbjct: 430 LVKSRPLSKFLTQTVIETGDILGRPVELILGFSQLEWERANCGMFLYWH 478 >ref|XP_003612418.1| MORC family CW-type zinc finger protein [Medicago truncatula] gi|355513753|gb|AES95376.1| MORC family CW-type zinc finger protein [Medicago truncatula] Length = 577 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PLA F + T+I G I+G++++LIL QLEW+QA+CG+FLYWH Sbjct: 319 LVKSRPLANFLTNTIIATGDILGRAVELILGFSQLEWDQASCGVFLYWH 367 >ref|XP_004512434.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Cicer arietinum] Length = 737 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PLA F + TVI G I+G+ ++LIL QL+W+QA+CGIFLYWH Sbjct: 486 LVKSRPLANFLTNTVIATGDILGRPVELILGFSQLKWDQASCGIFLYWH 534 >ref|XP_006573514.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform X7 [Glycine max] Length = 657 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PL F ++ VIE I+G+ ++LIL QLEWEQANCG+FLYWH Sbjct: 404 LVKSRPLGNFLTQIVIETDNILGRPVELILGFSQLEWEQANCGMFLYWH 452 >ref|XP_006573513.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform X6 [Glycine max] Length = 659 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PL F ++ VIE I+G+ ++LIL QLEWEQANCG+FLYWH Sbjct: 434 LVKSRPLGNFLTQIVIETDNILGRPVELILGFSQLEWEQANCGMFLYWH 482 >ref|XP_006573512.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform X5 [Glycine max] Length = 661 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PL F ++ VIE I+G+ ++LIL QLEWEQANCG+FLYWH Sbjct: 408 LVKSRPLGNFLTQIVIETDNILGRPVELILGFSQLEWEQANCGMFLYWH 456 >ref|XP_006573511.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform X4 [Glycine max] Length = 672 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 148 LVKAHPLARFPSKTVIENGVIMGKSIQLILRRCQLEWEQANCGIFLYWH 2 LVK+ PL F ++ VIE I+G+ ++LIL QLEWEQANCG+FLYWH Sbjct: 434 LVKSRPLGNFLTQIVIETDNILGRPVELILGFSQLEWEQANCGMFLYWH 482