BLASTX nr result
ID: Rheum21_contig00026085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00026085 (422 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369348.1| hypothetical protein POPTR_0001s21620g [Popu... 56 6e-06 ref|XP_002298187.1| predicted protein [Populus trichocarpa] 56 6e-06 ref|XP_006377659.1| hypothetical protein POPTR_0011s09780g [Popu... 55 1e-05 ref|XP_006377658.1| hypothetical protein POPTR_0011s09780g [Popu... 55 1e-05 >ref|XP_006369348.1| hypothetical protein POPTR_0001s21620g [Populus trichocarpa] gi|550347828|gb|ERP65917.1| hypothetical protein POPTR_0001s21620g [Populus trichocarpa] Length = 800 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +2 Query: 185 KDDRRYFIVNVVILKIFFNLIQRICPRPSLLDMFLEFVEYVLYDKICT 328 KDD RY I+N+VI +IF +L + ICP L + FL FVEYVL +K C+ Sbjct: 323 KDDDRYVILNIVITEIFMHLSEWICPPAVLFEKFLTFVEYVLLEKSCS 370 >ref|XP_002298187.1| predicted protein [Populus trichocarpa] Length = 834 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +2 Query: 185 KDDRRYFIVNVVILKIFFNLIQRICPRPSLLDMFLEFVEYVLYDKICT 328 KDD RY I+N+VI +IF +L + ICP L + FL FVEYVL +K C+ Sbjct: 365 KDDDRYVILNIVITEIFMHLSEWICPPAVLFEKFLTFVEYVLLEKSCS 412 >ref|XP_006377659.1| hypothetical protein POPTR_0011s09780g [Populus trichocarpa] gi|550328029|gb|ERP55456.1| hypothetical protein POPTR_0011s09780g [Populus trichocarpa] Length = 855 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +2 Query: 185 KDDRRYFIVNVVILKIFFNLIQRICPRPSLLDMFLEFVEYVLYDKICT 328 KDD RY I N+VI +IF +L + ICP L + FL FVEYVL +K C+ Sbjct: 352 KDDDRYVIFNIVITEIFMHLSEWICPPAVLFEKFLTFVEYVLLEKSCS 399 >ref|XP_006377658.1| hypothetical protein POPTR_0011s09780g [Populus trichocarpa] gi|566194644|ref|XP_002317365.2| hypothetical protein POPTR_0011s09780g [Populus trichocarpa] gi|550328027|gb|ERP55455.1| hypothetical protein POPTR_0011s09780g [Populus trichocarpa] gi|550328028|gb|EEE97977.2| hypothetical protein POPTR_0011s09780g [Populus trichocarpa] Length = 826 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +2 Query: 185 KDDRRYFIVNVVILKIFFNLIQRICPRPSLLDMFLEFVEYVLYDKICT 328 KDD RY I N+VI +IF +L + ICP L + FL FVEYVL +K C+ Sbjct: 323 KDDDRYVIFNIVITEIFMHLSEWICPPAVLFEKFLTFVEYVLLEKSCS 370