BLASTX nr result
ID: Rheum21_contig00025654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00025654 (509 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004496553.1| PREDICTED: 60S ribosomal protein L36-2-like ... 57 3e-06 gb|EMJ07364.1| hypothetical protein PRUPE_ppa013654mg [Prunus pe... 56 6e-06 gb|EMJ19827.1| hypothetical protein PRUPE_ppa013641mg [Prunus pe... 55 1e-05 pir||T14304 ribosomal protein - carrot (fragment) gi|1276967|gb|... 55 1e-05 gb|AFK43005.1| unknown [Lotus japonicus] 55 1e-05 gb|AFK38454.1| unknown [Lotus japonicus] 55 1e-05 >ref|XP_004496553.1| PREDICTED: 60S ribosomal protein L36-2-like [Cicer arietinum] gi|502128416|ref|XP_004499956.1| PREDICTED: 60S ribosomal protein L36-2-like [Cicer arietinum] gi|502151759|ref|XP_004508599.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X1 [Cicer arietinum] gi|502151761|ref|XP_004508600.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Cicer arietinum] gi|502157934|ref|XP_004510961.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X2 [Cicer arietinum] Length = 110 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = +2 Query: 374 RRPAEAFFVGLNKSHIVTKNELAPRPSDRKGICCLSIHCTRN 499 ++P+ FVGLNK H+VTK ELAPRPSDRKG +H RN Sbjct: 4 KQPSTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRN 45 >gb|EMJ07364.1| hypothetical protein PRUPE_ppa013654mg [Prunus persica] Length = 110 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = +2 Query: 380 PAEAFFVGLNKSHIVTKNELAPRPSDRKGICCLSIHCTRN 499 P FVGLNK HIVTK ELAPRPSDRKG +H RN Sbjct: 6 PKSGIFVGLNKGHIVTKRELAPRPSDRKGKTSKRVHFVRN 45 >gb|EMJ19827.1| hypothetical protein PRUPE_ppa013641mg [Prunus persica] Length = 111 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +2 Query: 374 RRPAEAFFVGLNKSHIVTKNELAPRPSDRKGICCLSIHCTRN 499 ++P FVGLNK HIVT+ ELAPRPSDRKG +H RN Sbjct: 4 KQPNTGIFVGLNKGHIVTRKELAPRPSDRKGKTSKRVHFVRN 45 >pir||T14304 ribosomal protein - carrot (fragment) gi|1276967|gb|AAB01095.1| putative ribosomal protein, partial [Daucus carota] Length = 111 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = +2 Query: 362 SMDLRRPAEAFFVGLNKSHIVTKNELAPRPSDRKGICCLSIHCTRN 499 +M ++P FVGLNK HIVTK ELAPRPSDRKG H RN Sbjct: 5 NMAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRTHFVRN 50 >gb|AFK43005.1| unknown [Lotus japonicus] Length = 111 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +2 Query: 374 RRPAEAFFVGLNKSHIVTKNELAPRPSDRKGICCLSIHCTRN 499 ++P+ FVGLNK H+VTK ELAPRPSDRKG +H R+ Sbjct: 4 KQPSTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRS 45 >gb|AFK38454.1| unknown [Lotus japonicus] Length = 110 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +2 Query: 374 RRPAEAFFVGLNKSHIVTKNELAPRPSDRKGICCLSIHCTRN 499 ++P+ FVGLNK H+VTK ELAPRPSDRKG +H R+ Sbjct: 4 KQPSTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRS 45