BLASTX nr result
ID: Rheum21_contig00025554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00025554 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADV40117.1| putative E3 ubiquitin ligase [Latrodectus hesperus] 58 1e-06 ref|XP_003628487.1| Cellular nucleic acid-binding protein [Medic... 57 3e-06 >gb|ADV40117.1| putative E3 ubiquitin ligase [Latrodectus hesperus] Length = 175 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/84 (35%), Positives = 43/84 (51%) Frame = +3 Query: 39 QAGGFKRPAPPSDFAKSGRARTDKAPEKSLRHSGQAKGSVQCYNCGVAGHKSTECQKEKK 218 ++G F R P D + G R D R S +A CYNCG +GH + EC++ K Sbjct: 11 KSGHFARDCPSGDGGRGGGYRGDS------RSSSRAS----CYNCGRSGHFARECRESDK 60 Query: 219 TCFGCGREGHQQRFYLKGQPKGAE 290 TC+ CG+ GH R +G G++ Sbjct: 61 TCYSCGKSGHISRDCTQGGGGGSD 84 >ref|XP_003628487.1| Cellular nucleic acid-binding protein [Medicago truncatula] gi|355522509|gb|AET02963.1| Cellular nucleic acid-binding protein [Medicago truncatula] Length = 544 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/81 (34%), Positives = 41/81 (50%) Frame = +3 Query: 6 RESQRQVQNQSQAGGFKRPAPPSDFAKSGRARTDKAPEKSLRHSGQAKGSVQCYNCGVAG 185 ++ + + +S G RP P S A G+ R + + R A + CY CG G Sbjct: 194 KDHYKVMSERSGKGQQSRPKPYSAPADKGKQRLNDERRPNRR---DAPAEIVCYKCGDKG 250 Query: 186 HKSTECQKEKKTCFGCGREGH 248 HKS C K++K CF CG++GH Sbjct: 251 HKSNVCTKDEKKCFRCGQKGH 271