BLASTX nr result
ID: Rheum21_contig00025382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00025382 (541 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300361.2| CBS domain-containing family protein [Populu... 60 3e-07 gb|EMJ14793.1| hypothetical protein PRUPE_ppa002455mg [Prunus pe... 59 1e-06 gb|EXB96351.1| hypothetical protein L484_023070 [Morus notabilis] 58 1e-06 gb|EXB67418.1| DUF21 domain-containing protein [Morus notabilis] 58 1e-06 ref|XP_004294465.1| PREDICTED: DUF21 domain-containing protein A... 57 4e-06 >ref|XP_002300361.2| CBS domain-containing family protein [Populus trichocarpa] gi|550349088|gb|EEE85166.2| CBS domain-containing family protein [Populus trichocarpa] Length = 448 Score = 60.1 bits (144), Expect = 3e-07 Identities = 47/139 (33%), Positives = 64/139 (46%), Gaps = 1/139 (0%) Frame = -1 Query: 469 SRMPVKISSR-IAYRPFITNCMKKTVFVSSFTSVTPQNRCLQCLNYRNHGRLVLGDGTQG 293 S++P K+S + Y P I++ K T F +S+ P+NR N LG Sbjct: 33 SKIPFKVSQKSYQYPPRISS--KLTDFRPYCSSILPRNRSKSSRNVSTD----LGTDQN- 85 Query: 292 QTXXXXXXXXXXXXXFKVMIKXXXXXXXXXXXXXVFQCQRATAVEGAVNKAYDVVEHSML 113 KV++K VF C+R A EG VN Y V+ S+L Sbjct: 86 ----------VNLELIKVLLKRGVVFGAMVCGVLVFGCRRVLASEGVVNAGYGVIGQSIL 135 Query: 112 LLKNAWPKILQLLQVIREQ 56 LL+NAWPKI QLL+V +EQ Sbjct: 136 LLRNAWPKISQLLRVFKEQ 154 >gb|EMJ14793.1| hypothetical protein PRUPE_ppa002455mg [Prunus persica] Length = 671 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -1 Query: 187 FQCQRATAVEGAVNKAYDVVEHSMLLLKNAWPKILQLLQVIREQ 56 + C+RA AVEG VN Y V+ S+LLL+NAWPK LQ+LQ+ +EQ Sbjct: 120 YGCRRAFAVEGVVNAGYGVIGQSILLLRNAWPKTLQVLQLFKEQ 163 >gb|EXB96351.1| hypothetical protein L484_023070 [Morus notabilis] Length = 358 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -1 Query: 187 FQCQRATAVEGAVNKAYDVVEHSMLLLKNAWPKILQLLQVIREQ 56 + C+RA A EG VN Y V+ S+LLL+NAWPK LQ+LQV +EQ Sbjct: 113 YGCKRAFATEGVVNAGYGVIGQSILLLRNAWPKTLQVLQVFKEQ 156 >gb|EXB67418.1| DUF21 domain-containing protein [Morus notabilis] Length = 659 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -1 Query: 187 FQCQRATAVEGAVNKAYDVVEHSMLLLKNAWPKILQLLQVIREQ 56 + C+RA A EG VN Y V+ S+LLL+NAWPK LQ+LQV +EQ Sbjct: 113 YGCKRAFATEGVVNAGYGVIGQSILLLRNAWPKTLQVLQVFKEQ 156 >ref|XP_004294465.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 665 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/63 (46%), Positives = 40/63 (63%) Frame = -1 Query: 244 KVMIKXXXXXXXXXXXXXVFQCQRATAVEGAVNKAYDVVEHSMLLLKNAWPKILQLLQVI 65 KVM+K V+ +RA AVEG V+ +Y VV+ S+L+ +NAWPK LQ+LQV Sbjct: 101 KVMVKCGVVLAAMVCGVLVYGSRRAFAVEGVVSASYGVVDKSILMFRNAWPKTLQVLQVF 160 Query: 64 REQ 56 +EQ Sbjct: 161 KEQ 163