BLASTX nr result
ID: Rheum21_contig00025341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00025341 (215 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ16089.1| hypothetical protein PRUPE_ppa001014mg [Prunus pe... 87 2e-15 emb|CAN73858.1| hypothetical protein VITISV_024322 [Vitis vinifera] 86 5e-15 ref|XP_004305676.1| PREDICTED: putative pentatricopeptide repeat... 84 3e-14 ref|XP_002268817.2| PREDICTED: putative pentatricopeptide repeat... 84 3e-14 ref|XP_002530214.1| pentatricopeptide repeat-containing protein,... 84 3e-14 gb|EXB70651.1| hypothetical protein L484_023837 [Morus notabilis] 83 3e-14 gb|EOX93509.1| Tetratricopeptide repeat-like superfamily protein... 82 1e-13 ref|XP_003545066.1| PREDICTED: putative pentatricopeptide repeat... 81 2e-13 gb|ESW14531.1| hypothetical protein PHAVU_008G289100g [Phaseolus... 80 4e-13 ref|XP_004491623.1| PREDICTED: putative pentatricopeptide repeat... 79 8e-13 ref|XP_006376468.1| hypothetical protein POPTR_0013s13270g [Popu... 78 1e-12 ref|XP_003609218.1| Pentatricopeptide repeat-containing protein ... 78 1e-12 ref|XP_006447804.1| hypothetical protein CICLE_v10017893mg [Citr... 77 3e-12 ref|XP_002330643.1| predicted protein [Populus trichocarpa] 77 3e-12 ref|XP_004144619.1| PREDICTED: putative pentatricopeptide repeat... 75 9e-12 ref|XP_006357638.1| PREDICTED: putative pentatricopeptide repeat... 74 2e-11 gb|EPS62296.1| hypothetical protein M569_12493 [Genlisea aurea] 74 2e-11 ref|XP_004243876.1| PREDICTED: putative pentatricopeptide repeat... 74 2e-11 ref|XP_006376473.1| hypothetical protein POPTR_0013s13310g [Popu... 72 6e-11 ref|XP_006397508.1| hypothetical protein EUTSA_v10001296mg [Eutr... 71 1e-10 >gb|EMJ16089.1| hypothetical protein PRUPE_ppa001014mg [Prunus persica] Length = 934 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L Q+L RV KSG L DLYVGSALVSG+ARFGLIDYAR+I EQ+S +NA+S+NGLMV Sbjct: 169 LLQQILTRVNKSGILQDLYVGSALVSGFARFGLIDYARKIFEQMSERNAISMNGLMV 225 >emb|CAN73858.1| hypothetical protein VITISV_024322 [Vitis vinifera] Length = 1539 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/57 (71%), Positives = 50/57 (87%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+QMLARV+KSGFL DLYVGSALVSG+ARFGL D A+ I EQ+ ++N VS+NGLMV Sbjct: 773 VLEQMLARVEKSGFLQDLYVGSALVSGFARFGLTDDAKNIFEQMGVRNVVSMNGLMV 829 >ref|XP_004305676.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Fragaria vesca subsp. vesca] Length = 1043 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/57 (70%), Positives = 49/57 (85%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L QML+RV K+GFL DLYVGSALVSG+AR GL+DYAR+I EQ+ +N VS+NGLMV Sbjct: 278 LLQQMLSRVCKAGFLGDLYVGSALVSGFARVGLVDYARKIFEQMGERNVVSMNGLMV 334 >ref|XP_002268817.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Vitis vinifera] Length = 1736 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/57 (70%), Positives = 49/57 (85%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+QMLARV+KSGFL DLYV SALVSG+ARFGL D A+ I EQ+ ++N VS+NGLMV Sbjct: 300 VLEQMLARVEKSGFLQDLYVSSALVSGFARFGLTDDAKNIFEQMGVRNVVSMNGLMV 356 >ref|XP_002530214.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530261|gb|EEF32161.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 834 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+QML V+KSG LSD+YVGSALVSG++RFGL DYA++I EQ+ ++NAVS+N LMV Sbjct: 164 LLEQMLTMVEKSGLLSDMYVGSALVSGFSRFGLFDYAKKIFEQMGMRNAVSMNSLMV 220 >gb|EXB70651.1| hypothetical protein L484_023837 [Morus notabilis] Length = 1398 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/57 (70%), Positives = 53/57 (92%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+QMLARV+KSGFL+DLYVGSALVSG+++FGL++YA +I EQ+S N+VS+NGLMV Sbjct: 306 LLEQMLARVKKSGFLNDLYVGSALVSGFSKFGLLNYALKISEQMSEINSVSMNGLMV 362 >gb|EOX93509.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 1161 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/57 (70%), Positives = 49/57 (85%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L QML+R+ KSGFLSDLYVGSALVSG+AR GL +YA +I Q+S +NAVS+NGLMV Sbjct: 311 LLQQMLSRITKSGFLSDLYVGSALVSGFARLGLSNYAMKIFGQMSQRNAVSMNGLMV 367 >ref|XP_003545066.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Glycine max] Length = 1033 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+QMLAR++KS F+ DLYVGSALVSG+AR+GLID A+ I EQ+ +NAV++NGLMV Sbjct: 268 LLEQMLARIEKSSFVKDLYVGSALVSGFARYGLIDSAKMIFEQMDDRNAVTMNGLMV 324 >gb|ESW14531.1| hypothetical protein PHAVU_008G289100g [Phaseolus vulgaris] Length = 1030 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+QMLAR++KS F+ DLYVGSALVSG+A+ GLID A+ I EQ+S +NAV++NGLMV Sbjct: 265 LLEQMLARIEKSSFVQDLYVGSALVSGFAKHGLIDSAKMIFEQMSDRNAVTMNGLMV 321 >ref|XP_004491623.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cicer arietinum] Length = 1030 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/57 (63%), Positives = 50/57 (87%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+QML R++KSGF+ DLYVGSALV+G+AR+GL+D A+ I EQ+ +NAV++NGLMV Sbjct: 265 VLEQMLTRIEKSGFVHDLYVGSALVNGFARYGLMDCAKMIFEQMYDRNAVTMNGLMV 321 >ref|XP_006376468.1| hypothetical protein POPTR_0013s13270g [Populus trichocarpa] gi|550325744|gb|ERP54265.1| hypothetical protein POPTR_0013s13270g [Populus trichocarpa] Length = 934 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/57 (63%), Positives = 49/57 (85%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L Q+LAR++KSG L++LYVGSALV G++R G DYAR+I EQ++ +NAVS+NGLMV Sbjct: 169 LLGQILARIKKSGLLANLYVGSALVGGFSRLGSFDYARKIFEQMTARNAVSMNGLMV 225 >ref|XP_003609218.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510273|gb|AES91415.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1134 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/57 (63%), Positives = 50/57 (87%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+QML R++KSGFL DLYVGSALV+G+AR+GL+D A+ I +Q+ +NAV++NGLMV Sbjct: 369 LLEQMLTRIEKSGFLRDLYVGSALVNGFARYGLMDCAKMIFKQMYDRNAVTMNGLMV 425 >ref|XP_006447804.1| hypothetical protein CICLE_v10017893mg [Citrus clementina] gi|568830346|ref|XP_006469462.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Citrus sinensis] gi|557550415|gb|ESR61044.1| hypothetical protein CICLE_v10017893mg [Citrus clementina] Length = 1057 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/58 (65%), Positives = 47/58 (81%) Frame = +2 Query: 41 FILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 ++L Q+LA V+K+G LSDLYVGSALVSG+AR G YAR+I EQ+ KN VS+NGLMV Sbjct: 292 YLLQQILAMVKKAGLLSDLYVGSALVSGFARLGNFYYARKIFEQMIQKNVVSMNGLMV 349 >ref|XP_002330643.1| predicted protein [Populus trichocarpa] Length = 777 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/57 (61%), Positives = 48/57 (84%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L Q+LAR++KSG L++LYVGSAL G++R G DYAR+I EQ++ +NAVS+NGLMV Sbjct: 169 LLGQILARIKKSGLLANLYVGSALAGGFSRLGSFDYARKIFEQMTARNAVSMNGLMV 225 >ref|XP_004144619.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cucumis sativus] gi|449506934|ref|XP_004162888.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cucumis sativus] Length = 1067 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/57 (59%), Positives = 48/57 (84%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+Q+L RV+KSGFL DLYVGSALVSG+A+ G I YA+ I +++S +N VS+NGL++ Sbjct: 302 LLEQLLTRVEKSGFLHDLYVGSALVSGFAKAGSIGYAKNIFQKMSYRNVVSLNGLII 358 >ref|XP_006357638.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Solanum tuberosum] Length = 1086 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/57 (57%), Positives = 47/57 (82%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+Q+LA ++KSG L DLYVGSAL+SG+ RFG +D A ++ +Q+ +NAVS+NGLMV Sbjct: 321 LLEQLLANIEKSGLLEDLYVGSALLSGFGRFGSLDTALKVFKQMGARNAVSLNGLMV 377 >gb|EPS62296.1| hypothetical protein M569_12493 [Genlisea aurea] Length = 1061 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/57 (57%), Positives = 47/57 (82%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+Q+LAR++ SGF DLYVGSALV+G+AR G +D A+++ + +KNAVS+NGLMV Sbjct: 293 LLEQLLARIEMSGFSQDLYVGSALVNGFARCGAVDAAKKVFRHMGVKNAVSLNGLMV 349 >ref|XP_004243876.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Solanum lycopersicum] Length = 1086 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/57 (57%), Positives = 47/57 (82%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L+Q+LA ++KSG L DLYVGSAL+SG+ RFG +D A ++ +Q+ +NAVS+NGLMV Sbjct: 321 LLEQLLANIEKSGLLEDLYVGSALLSGFGRFGSLDTALKVFKQMGARNAVSLNGLMV 377 >ref|XP_006376473.1| hypothetical protein POPTR_0013s13310g [Populus trichocarpa] gi|550325749|gb|ERP54270.1| hypothetical protein POPTR_0013s13310g [Populus trichocarpa] Length = 909 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L Q+LAR++KSG L++LYVGSAL G +R G DYAR+I EQ++ +N V++NGLMV Sbjct: 301 LLGQILARIKKSGLLANLYVGSALAGGLSRLGSFDYARKIFEQMTARNVVAMNGLMV 357 >ref|XP_006397508.1| hypothetical protein EUTSA_v10001296mg [Eutrema salsugineum] gi|557098581|gb|ESQ38961.1| hypothetical protein EUTSA_v10001296mg [Eutrema salsugineum] Length = 934 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/57 (56%), Positives = 45/57 (78%) Frame = +2 Query: 44 ILDQMLARVQKSGFLSDLYVGSALVSGYARFGLIDYARRILEQLSLKNAVSVNGLMV 214 +L Q++ +QKSGFLSDL+VGS LVS +A+ G + YAR+I Q+ +NAV++NGLMV Sbjct: 165 LLQQIMCTIQKSGFLSDLFVGSGLVSAFAKSGSLSYARKIFNQMETRNAVTLNGLMV 221