BLASTX nr result
ID: Rheum21_contig00024870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00024870 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ09594.1| hypothetical protein PRUPE_ppa000169mg [Prunus pe... 62 8e-08 gb|EXC16279.1| E3 ubiquitin-protein ligase UPL4 [Morus notabilis] 60 2e-07 ref|XP_006398746.1| hypothetical protein EUTSA_v10012430mg [Eutr... 60 3e-07 ref|XP_006398744.1| hypothetical protein EUTSA_v10012430mg [Eutr... 60 3e-07 ref|XP_002525185.1| ubiquitin protein ligase E3a, putative [Rici... 60 3e-07 ref|XP_004306227.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 60 4e-07 ref|XP_002273203.2| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 59 7e-07 emb|CBI32615.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_003541402.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 59 9e-07 ref|XP_004246696.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 58 1e-06 ref|XP_003537253.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 57 2e-06 ref|XP_004497459.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 57 3e-06 ref|XP_006381496.1| hypothetical protein POPTR_0006s13410g [Popu... 57 3e-06 gb|EOY07744.1| Ubiquitin protein ligase E3a, putative isoform 2 ... 57 3e-06 gb|EOY07743.1| Ubiquitin protein ligase E3a, putative isoform 1 ... 57 3e-06 ref|XP_002870997.1| ubiquitin-protein ligase 4 [Arabidopsis lyra... 57 3e-06 ref|XP_006361773.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 56 6e-06 ref|XP_006286912.1| hypothetical protein CARUB_v10000054mg [Caps... 56 6e-06 ref|XP_006286911.1| hypothetical protein CARUB_v10000054mg [Caps... 56 6e-06 ref|XP_004302599.1| PREDICTED: monothiol glutaredoxin-S16, chlor... 55 7e-06 >gb|EMJ09594.1| hypothetical protein PRUPE_ppa000169mg [Prunus persica] Length = 1542 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYE 503 R ALSTVVNIC+KLPSECP+P M+ VP LC+LL YE Sbjct: 249 RVALSTVVNICKKLPSECPSPFMEAVPILCNLLQYE 284 >gb|EXC16279.1| E3 ubiquitin-protein ligase UPL4 [Morus notabilis] Length = 1554 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R ALSTV+NIC+KLPSEC APIM+ VP LC+LL YE R Sbjct: 246 RVALSTVMNICKKLPSECHAPIMEAVPILCNLLQYEDR 283 >ref|XP_006398746.1| hypothetical protein EUTSA_v10012430mg [Eutrema salsugineum] gi|557099836|gb|ESQ40199.1| hypothetical protein EUTSA_v10012430mg [Eutrema salsugineum] Length = 1543 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R A+STVVNICRKLPSE P+P MD VP LC+LL YE R Sbjct: 249 RIAISTVVNICRKLPSESPSPFMDAVPILCNLLQYEDR 286 >ref|XP_006398744.1| hypothetical protein EUTSA_v10012430mg [Eutrema salsugineum] gi|567169712|ref|XP_006398745.1| hypothetical protein EUTSA_v10012430mg [Eutrema salsugineum] gi|557099834|gb|ESQ40197.1| hypothetical protein EUTSA_v10012430mg [Eutrema salsugineum] gi|557099835|gb|ESQ40198.1| hypothetical protein EUTSA_v10012430mg [Eutrema salsugineum] Length = 1503 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R A+STVVNICRKLPSE P+P MD VP LC+LL YE R Sbjct: 249 RIAISTVVNICRKLPSESPSPFMDAVPILCNLLQYEDR 286 >ref|XP_002525185.1| ubiquitin protein ligase E3a, putative [Ricinus communis] gi|223535482|gb|EEF37151.1| ubiquitin protein ligase E3a, putative [Ricinus communis] Length = 1561 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R +LSTVVNIC+KLP+ECP+P M+ VP LC++L YE R Sbjct: 250 RVSLSTVVNICKKLPTECPSPFMEAVPTLCNILQYEDR 287 >ref|XP_004306227.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Fragaria vesca subsp. vesca] Length = 1567 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYE 503 R ALSTVVNIC+KLPSE P+P MD VP LC+LL YE Sbjct: 248 RVALSTVVNICKKLPSEGPSPFMDAVPTLCNLLQYE 283 >ref|XP_002273203.2| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Vitis vinifera] Length = 1575 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R ALSTVVNIC+KLPSEC AP M VP LC+LL YE R Sbjct: 261 RVALSTVVNICKKLPSECTAPFMLAVPSLCNLLQYEDR 298 >emb|CBI32615.3| unnamed protein product [Vitis vinifera] Length = 1487 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R ALSTVVNIC+KLPSEC AP M VP LC+LL YE R Sbjct: 261 RVALSTVVNICKKLPSECTAPFMLAVPSLCNLLQYEDR 298 >ref|XP_003541402.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X1 [Glycine max] gi|571498080|ref|XP_006594113.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X2 [Glycine max] gi|571498082|ref|XP_006594114.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X3 [Glycine max] Length = 1558 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R ALSTVVNIC+KLPSE P+P M+ VP LC+LL YE R Sbjct: 246 RVALSTVVNICKKLPSESPSPFMEAVPILCNLLQYEDR 283 >ref|XP_004246696.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Solanum lycopersicum] Length = 1553 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R AL TVVNIC+KLPS CP P+M+ VP LCDLL YE R Sbjct: 239 RKALLTVVNICKKLPSGCPPPLMEAVPVLCDLLLYEDR 276 >ref|XP_003537253.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X1 [Glycine max] gi|571481726|ref|XP_006588751.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X2 [Glycine max] gi|571481728|ref|XP_006588752.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X3 [Glycine max] gi|571481730|ref|XP_006588753.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X4 [Glycine max] gi|571481733|ref|XP_006588754.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X5 [Glycine max] gi|571481735|ref|XP_006588755.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X6 [Glycine max] Length = 1557 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R AL+TVVNIC+KLPSE P+P M+ VP LC+LL YE R Sbjct: 246 RVALATVVNICKKLPSESPSPFMEAVPILCNLLQYEDR 283 >ref|XP_004497459.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X1 [Cicer arietinum] gi|502121839|ref|XP_004497460.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X2 [Cicer arietinum] Length = 1556 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R ALSTVVNIC+KLPSE P P M+ VP LC+LL YE R Sbjct: 249 RVALSTVVNICKKLPSESPTPFMEAVPILCNLLLYEDR 286 >ref|XP_006381496.1| hypothetical protein POPTR_0006s13410g [Populus trichocarpa] gi|550336200|gb|ERP59293.1| hypothetical protein POPTR_0006s13410g [Populus trichocarpa] Length = 1574 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R ALSTVVNIC+KLPSE +P M+ VPRLC+LL YE R Sbjct: 248 RVALSTVVNICKKLPSENFSPFMEAVPRLCNLLQYEDR 285 >gb|EOY07744.1| Ubiquitin protein ligase E3a, putative isoform 2 [Theobroma cacao] Length = 1536 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYE 503 R ALSTVVNIC+KLP E PAP ++ VP+LCDLL +E Sbjct: 252 RVALSTVVNICKKLPLEGPAPFVEAVPKLCDLLQHE 287 >gb|EOY07743.1| Ubiquitin protein ligase E3a, putative isoform 1 [Theobroma cacao] gi|508715848|gb|EOY07745.1| Ubiquitin protein ligase E3a, putative isoform 1 [Theobroma cacao] Length = 1571 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYE 503 R ALSTVVNIC+KLP E PAP ++ VP+LCDLL +E Sbjct: 252 RVALSTVVNICKKLPLEGPAPFVEAVPKLCDLLQHE 287 >ref|XP_002870997.1| ubiquitin-protein ligase 4 [Arabidopsis lyrata subsp. lyrata] gi|297316834|gb|EFH47256.1| ubiquitin-protein ligase 4 [Arabidopsis lyrata subsp. lyrata] Length = 1509 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R A+STVVNICRKLPSE +P MD VP LC+LL YE R Sbjct: 249 RVAISTVVNICRKLPSEPASPFMDAVPILCNLLQYEDR 286 >ref|XP_006361773.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Solanum tuberosum] Length = 1554 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R AL TVVNIC+KLPS CP P+M+ VP LC+LL YE R Sbjct: 241 RKALLTVVNICKKLPSGCPPPLMEAVPVLCNLLLYEDR 278 >ref|XP_006286912.1| hypothetical protein CARUB_v10000054mg [Capsella rubella] gi|482555618|gb|EOA19810.1| hypothetical protein CARUB_v10000054mg [Capsella rubella] Length = 1274 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R A+STVVNICRKLPSE P+ MD VP LC++L YE R Sbjct: 16 RVAISTVVNICRKLPSESPSLFMDAVPILCNILQYEDR 53 >ref|XP_006286911.1| hypothetical protein CARUB_v10000054mg [Capsella rubella] gi|482555617|gb|EOA19809.1| hypothetical protein CARUB_v10000054mg [Capsella rubella] Length = 1181 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 396 RTALSTVVNICRKLPSECPAPIMDTVPRLCDLLHYELR 509 R A+STVVNICRKLPSE P+ MD VP LC++L YE R Sbjct: 16 RVAISTVVNICRKLPSESPSLFMDAVPILCNILQYEDR 53 >ref|XP_004302599.1| PREDICTED: monothiol glutaredoxin-S16, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 293 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +2 Query: 215 IYDQANELQFVGLSRNVATSILAHRKSVSELCSVVK 322 ++DQ ELQFVGLSRN+A SIL HRKSV ELC VK Sbjct: 90 VFDQNGELQFVGLSRNIAASILVHRKSVPELCHSVK 125