BLASTX nr result
ID: Rheum21_contig00024094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00024094 (494 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60153.1| hypothetical protein VITISV_021504 [Vitis vinifera] 67 3e-09 >emb|CAN60153.1| hypothetical protein VITISV_021504 [Vitis vinifera] Length = 1688 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +2 Query: 347 DRS*SWGKCKAMHGREDGENRKRSRHMWSVASRGSTATVGVDSGSSSVN 493 DRS +W KCKAMHGRE GE+RKRSRHMWSV +RG TA+V DS +S+ N Sbjct: 23 DRSGNWQKCKAMHGRE-GEDRKRSRHMWSVPTRG-TASVADDSSTSTAN 69