BLASTX nr result
ID: Rheum21_contig00022919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00022919 (233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535721.2| PREDICTED: uncharacterized protein LOC100779... 57 3e-06 gb|ESW14924.1| hypothetical protein PHAVU_007G029200g [Phaseolus... 55 1e-05 gb|EOY00113.1| Uncharacterized protein TCM_009632 [Theobroma cacao] 55 1e-05 >ref|XP_003535721.2| PREDICTED: uncharacterized protein LOC100779683 [Glycine max] Length = 257 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +2 Query: 122 SEARFLMAMAPERSRSLHNFSLPRLKWGSQRQLRCVK 232 SE MAM PERS+ LHNF LP LKWGSQR LRC K Sbjct: 6 SEKEVSMAMGPERSKPLHNFMLPCLKWGSQRHLRCTK 42 >gb|ESW14924.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris] Length = 263 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +2 Query: 122 SEARFLMAMAPERSRSLHNFSLPRLKWGSQRQLRCVK 232 SE MAM PERS+ LHNF LP LKWGSQR LRC K Sbjct: 6 SEEGESMAMGPERSKPLHNFMLPCLKWGSQRHLRCTK 42 >gb|EOY00113.1| Uncharacterized protein TCM_009632 [Theobroma cacao] Length = 312 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +2 Query: 140 MAMAPERSRSLHNFSLPRLKWGSQRQLRCVK 232 MAM PERS+ LHNF LP LKWG+QR LRCVK Sbjct: 12 MAMGPERSKPLHNFKLPCLKWGNQRYLRCVK 42