BLASTX nr result
ID: Rheum21_contig00022524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00022524 (210 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putativ... 56 4e-06 >ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223545494|gb|EEF46999.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Length = 729 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 121 VSRSPARSPRRGNRRSYSRSLSPVRKAMSPPSERRRSLSK 2 VSRSP R+P R NRRS+SRS SPVR+A SPPS+ RRSLS+ Sbjct: 513 VSRSPVRAPCRNNRRSFSRSRSPVRRARSPPSD-RRSLSR 551