BLASTX nr result
ID: Rheum21_contig00022180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00022180 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY21663.1| DDT domain-containing protein [Theobroma cacao] 57 3e-06 ref|XP_002318002.2| hypothetical protein POPTR_0012s07420g [Popu... 55 1e-05 >gb|EOY21663.1| DDT domain-containing protein [Theobroma cacao] Length = 730 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 193 KTRFLDLNEAAPGSGFDDGPGALMKDSGKND 101 K RFLDLNE APGSGFDDGP +MKD G+ND Sbjct: 699 KRRFLDLNELAPGSGFDDGPNTIMKDDGRND 729 >ref|XP_002318002.2| hypothetical protein POPTR_0012s07420g [Populus trichocarpa] gi|550326583|gb|EEE96222.2| hypothetical protein POPTR_0012s07420g [Populus trichocarpa] Length = 717 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = -1 Query: 247 QGPFGEPTSVNQELGELGKTRFLDLNEAAPGSGFDDGPGALMKDSGKND 101 Q P + V +E+ + K RFLDLNE APGSGFDD P +MKD +ND Sbjct: 668 QPPEESNSPVQEEVEGVRKRRFLDLNELAPGSGFDDSPNTVMKDEDRND 716