BLASTX nr result
ID: Rheum21_contig00021463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00021463 (635 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38648.1| Two-component response regulator [Morus notabilis] 82 1e-13 emb|CBI21084.3| unnamed protein product [Vitis vinifera] 79 1e-12 ref|XP_002282928.1| PREDICTED: two-component response regulator ... 79 1e-12 emb|CAN81109.1| hypothetical protein VITISV_010435 [Vitis vinifera] 79 1e-12 ref|XP_004157093.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 76 9e-12 ref|XP_004145510.1| PREDICTED: two-component response regulator ... 76 9e-12 gb|EMJ28014.1| hypothetical protein PRUPE_ppa024819mg, partial [... 75 2e-11 ref|XP_003546612.1| PREDICTED: two-component response regulator ... 74 3e-11 ref|XP_006655852.1| PREDICTED: two-component response regulator ... 72 1e-10 gb|ESW08961.1| hypothetical protein PHAVU_009G0889000g, partial ... 72 1e-10 gb|EOY29369.1| Type-b response regulator, putative [Theobroma ca... 72 1e-10 ref|NP_001056986.1| Os06g0183100 [Oryza sativa Japonica Group] g... 72 1e-10 ref|XP_003526216.1| PREDICTED: two-component response regulator ... 72 1e-10 ref|XP_002523510.1| two-component system sensor histidine kinase... 72 1e-10 gb|EEC80137.1| hypothetical protein OsI_21925 [Oryza sativa Indi... 72 1e-10 gb|EMT32656.1| Two-component response regulator ARR12 [Aegilops ... 72 1e-10 gb|EMS46078.1| Two-component response regulator ARR12 [Triticum ... 72 1e-10 ref|XP_004139402.1| PREDICTED: two-component response regulator ... 72 1e-10 ref|XP_002515447.1| two-component system sensor histidine kinase... 72 1e-10 ref|XP_006587150.1| PREDICTED: two-component response regulator ... 72 2e-10 >gb|EXB38648.1| Two-component response regulator [Morus notabilis] Length = 674 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTS 626 MTVE RND+ DQFP+GMRVLAVDDDP CL LLETLLR+CQYHVT+ Sbjct: 1 MTVEQRNDDPRDQFPIGMRVLAVDDDPTCLLLLETLLRRCQYHVTT 46 >emb|CBI21084.3| unnamed protein product [Vitis vinifera] Length = 667 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTS 626 MTVE R ++ +DQFP+GMRVLAVDDDP CLRLL+TLLR+CQYHVT+ Sbjct: 1 MTVEPRVEDPNDQFPIGMRVLAVDDDPTCLRLLDTLLRRCQYHVTT 46 >ref|XP_002282928.1| PREDICTED: two-component response regulator ARR12-like [Vitis vinifera] Length = 693 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTS 626 MTVE R ++ +DQFP+GMRVLAVDDDP CLRLL+TLLR+CQYHVT+ Sbjct: 1 MTVEPRVEDPNDQFPIGMRVLAVDDDPTCLRLLDTLLRRCQYHVTT 46 >emb|CAN81109.1| hypothetical protein VITISV_010435 [Vitis vinifera] Length = 693 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTS 626 MTVE R ++ +DQFP+GMRVLAVDDDP CLRLL+TLLR+CQYHVT+ Sbjct: 1 MTVEPRVEDPNDQFPIGMRVLAVDDDPTCLRLLDTLLRRCQYHVTT 46 >ref|XP_004157093.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR12-like [Cucumis sativus] Length = 688 Score = 75.9 bits (185), Expect = 9e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 MTVE R D+ DQFP GMRVLAVDDDP CL +LETLLR+CQYHVT+ ++ Sbjct: 1 MTVESRLDDPVDQFPTGMRVLAVDDDPTCLLILETLLRRCQYHVTTTNQ 49 >ref|XP_004145510.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] Length = 688 Score = 75.9 bits (185), Expect = 9e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 MTVE R D+ DQFP GMRVLAVDDDP CL +LETLLR+CQYHVT+ ++ Sbjct: 1 MTVESRLDDPVDQFPTGMRVLAVDDDPTCLLILETLLRRCQYHVTTTNQ 49 >gb|EMJ28014.1| hypothetical protein PRUPE_ppa024819mg, partial [Prunus persica] Length = 659 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTS 626 MTVE DE DQFP+GMRVLAVDDDPICL+LL+ LLR+C+YHVT+ Sbjct: 1 MTVEGVLDEPRDQFPIGMRVLAVDDDPICLKLLDALLRRCKYHVTT 46 >ref|XP_003546612.1| PREDICTED: two-component response regulator ARR12-like [Glycine max] Length = 697 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +3 Query: 489 MTVE-MRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 M VE R DE D+FPVGMRVLAVDDDPICL++LE LLRKCQYHVT+ ++ Sbjct: 1 MAVEKQREDEGCDRFPVGMRVLAVDDDPICLKVLENLLRKCQYHVTTTNQ 50 >ref|XP_006655852.1| PREDICTED: two-component response regulator ARR12-like [Oryza brachyantha] Length = 695 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = +3 Query: 522 DQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 DQFPVGMRVLAVDDDP+CL++LETLLR+CQYHVTS ++ Sbjct: 20 DQFPVGMRVLAVDDDPVCLKVLETLLRRCQYHVTSTNQ 57 >gb|ESW08961.1| hypothetical protein PHAVU_009G0889000g, partial [Phaseolus vulgaris] Length = 425 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 MTVE R + ++FPVGMRVLAVDD+PICL +LE LLRKCQYHVT+ ++ Sbjct: 1 MTVEKRMGDSGEEFPVGMRVLAVDDNPICLMVLENLLRKCQYHVTTTNQ 49 >gb|EOY29369.1| Type-b response regulator, putative [Theobroma cacao] Length = 625 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTS 626 MTVE E DQFPVGMRVLAVDDDP CL LLETLLR+CQY+VT+ Sbjct: 1 MTVERAISEPKDQFPVGMRVLAVDDDPTCLLLLETLLRRCQYNVTT 46 >ref|NP_001056986.1| Os06g0183100 [Oryza sativa Japonica Group] gi|55771374|dbj|BAD72541.1| putative response regulator 9 [Oryza sativa Japonica Group] gi|113595026|dbj|BAF18900.1| Os06g0183100 [Oryza sativa Japonica Group] gi|118790746|tpd|FAA00255.1| TPA: response regulator [Oryza sativa Japonica Group] gi|215736874|dbj|BAG95803.1| unnamed protein product [Oryza sativa Japonica Group] gi|222635081|gb|EEE65213.1| hypothetical protein OsJ_20357 [Oryza sativa Japonica Group] Length = 696 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = +3 Query: 522 DQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 DQFPVGMRVLAVDDDP+CL++LETLLR+CQYHVTS ++ Sbjct: 20 DQFPVGMRVLAVDDDPVCLKVLETLLRRCQYHVTSTNQ 57 >ref|XP_003526216.1| PREDICTED: two-component response regulator ARR12 [Glycine max] Length = 696 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 MTVE + ++ D+FPVGMRVLAVDDDP CL +LETLLR+CQYH T+ ++ Sbjct: 1 MTVEKKMNDSGDEFPVGMRVLAVDDDPTCLLVLETLLRRCQYHATTTNQ 49 >ref|XP_002523510.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] gi|223537217|gb|EEF38849.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] Length = 676 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 MTVE + D+FPVGMRVLAVDDDPICL++L+TLL+KCQY VT+ ++ Sbjct: 1 MTVEDKRSSSEDKFPVGMRVLAVDDDPICLKVLDTLLKKCQYQVTTTNQ 49 >gb|EEC80137.1| hypothetical protein OsI_21925 [Oryza sativa Indica Group] Length = 696 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = +3 Query: 522 DQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 DQFPVGMRVLAVDDDP+CL++LETLLR+CQYHVTS ++ Sbjct: 20 DQFPVGMRVLAVDDDPVCLKVLETLLRRCQYHVTSTNQ 57 >gb|EMT32656.1| Two-component response regulator ARR12 [Aegilops tauschii] Length = 654 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +3 Query: 501 MRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 M + DQFPVGMRVLAVDDDP+CL++LE LLR+CQYHVT+ ++ Sbjct: 10 MERERERDQFPVGMRVLAVDDDPVCLKVLEVLLRRCQYHVTTTNQ 54 >gb|EMS46078.1| Two-component response regulator ARR12 [Triticum urartu] Length = 651 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +3 Query: 501 MRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 M + DQFPVGMRVLAVDDDP+CL++LE LLR+CQYHVT+ ++ Sbjct: 10 MERERERDQFPVGMRVLAVDDDPVCLKVLEVLLRRCQYHVTTTNQ 54 >ref|XP_004139402.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] gi|449494037|ref|XP_004159429.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] Length = 699 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/55 (61%), Positives = 44/55 (80%), Gaps = 6/55 (10%) Frame = +3 Query: 489 MTVEMRN------DEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 MTVE+R ++ +QFP+GMRVLAVDDDPICL++LE LLRKCQYHVT+ ++ Sbjct: 1 MTVEVRKTNLVGENDDMEQFPIGMRVLAVDDDPICLKVLENLLRKCQYHVTTTNQ 55 >ref|XP_002515447.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] gi|223545391|gb|EEF46896.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] Length = 663 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +3 Query: 489 MTVEMRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTS 626 MTVE E DQFP+GMRVLAVDDDP CL +LET LR+CQYHVT+ Sbjct: 1 MTVEQGAGEAKDQFPIGMRVLAVDDDPTCLLVLETFLRRCQYHVTT 46 >ref|XP_006587150.1| PREDICTED: two-component response regulator ARR12 isoform X2 [Glycine max] Length = 654 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = +3 Query: 489 MTVE-MRNDEHHDQFPVGMRVLAVDDDPICLRLLETLLRKCQYHVTSRDR 635 M VE R D D+FPVGMRVLAVDDDPICL++LE LLRKCQYHVT+ ++ Sbjct: 1 MAVENQREDGGCDRFPVGMRVLAVDDDPICLKVLENLLRKCQYHVTTTNQ 50