BLASTX nr result
ID: Rheum21_contig00021255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00021255 (755 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064095.1| orf105b gene product (mitochondrion) [Beta vulg... 59 2e-06 >ref|NP_064095.1| orf105b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435118|ref|YP_004222336.1| hypothetical protein BevumaM_p102 [Beta vulgaris subsp. maritima] gi|346683210|ref|YP_004842142.1| hypothetical protein BemaM_p098 [Beta macrocarpa] gi|9087344|dbj|BAA99488.1| orf105b [Beta vulgaris subsp. vulgaris] gi|317905672|emb|CBJ14067.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439851|emb|CBJ17557.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148061|emb|CBJ20724.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500128|emb|CBX24947.1| hypothetical protein [Beta macrocarpa] gi|384939126|emb|CBL51972.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 105 Score = 58.9 bits (141), Expect = 2e-06 Identities = 37/78 (47%), Positives = 43/78 (55%), Gaps = 4/78 (5%) Frame = +2 Query: 491 SPIKSTSDRFTKQGVKQGPD*LCSGRS*YCVQLRRSAGWK----DCXXXXXXXXXXXXXX 658 SPI+STSDRFT+QGVKQGP L + + + SAGW Sbjct: 19 SPIRSTSDRFTEQGVKQGPGYLWKNLAEVSI-VFNSAGWLVGRIAFCHLSFLSLSSLSKE 77 Query: 659 XRLKSNFWLATSWAQVSG 712 R KSNFWLATSWA+VSG Sbjct: 78 SRKKSNFWLATSWARVSG 95