BLASTX nr result
ID: Rheum21_contig00021129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00021129 (229 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164396.1| PREDICTED: U-box domain-containing protein 1... 56 4e-06 gb|ADN33842.1| ubiquitin-protein ligase [Cucumis melo subsp. melo] 56 4e-06 ref|XP_004135239.1| PREDICTED: U-box domain-containing protein 1... 56 6e-06 >ref|XP_004164396.1| PREDICTED: U-box domain-containing protein 19-like [Cucumis sativus] Length = 683 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/71 (39%), Positives = 44/71 (61%) Frame = -3 Query: 215 VSFVFLKELQEQISKNXXXXXXXXXXXXVHMVFQRIWFLLEDCTLQDARFLMLVKSSEVA 36 + F +ELQ++ S + +H++FQ+I +LLEDC L+ AR ML+KS +A Sbjct: 64 ILLAFFEELQDR-SSDEFSDLIVLVMSELHLIFQKILYLLEDCALEGARLFMLMKSELIA 122 Query: 35 NRYRVVVRDFA 3 NR+R++VR A Sbjct: 123 NRFRLLVRSVA 133 >gb|ADN33842.1| ubiquitin-protein ligase [Cucumis melo subsp. melo] Length = 671 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/42 (54%), Positives = 33/42 (78%) Frame = -3 Query: 128 HMVFQRIWFLLEDCTLQDARFLMLVKSSEVANRYRVVVRDFA 3 H++FQ+I +LLEDC L+ AR ML+KS +ANR+RV++R A Sbjct: 80 HLIFQKILYLLEDCALEGARLFMLMKSEHIANRFRVLIRSVA 121 >ref|XP_004135239.1| PREDICTED: U-box domain-containing protein 19-like [Cucumis sativus] Length = 683 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/67 (41%), Positives = 43/67 (64%) Frame = -3 Query: 203 FLKELQEQISKNXXXXXXXXXXXXVHMVFQRIWFLLEDCTLQDARFLMLVKSSEVANRYR 24 F +ELQ++ S + +H++FQ+I +LLEDC L+ AR ML+KS +ANR+R Sbjct: 68 FFEELQDR-SSDEFSDLIVLVMSELHLIFQKILYLLEDCALEGARLFMLMKSELIANRFR 126 Query: 23 VVVRDFA 3 ++VR A Sbjct: 127 LLVRSVA 133