BLASTX nr result
ID: Rheum21_contig00020943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00020943 (602 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR18787.1| class S F-box protein [Nicotiana alata] 58 2e-06 ref|XP_006447718.1| hypothetical protein CICLE_v10015458mg [Citr... 56 7e-06 >gb|ABR18787.1| class S F-box protein [Nicotiana alata] Length = 392 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/97 (30%), Positives = 47/97 (48%) Frame = -3 Query: 339 CPQRLFKGCYHWMARCEDRSYNALSFSFDDESFKLIAGPPTAPRRTLGDVFVLHHHLTFI 160 C F G +HW + Y +SF+F ESF++I P +FVL L I Sbjct: 228 CSHVFFNGAFHWRRYTKSDDYFIVSFNFSIESFQMIPSPEGLTDEGRKSLFVLSESLALI 287 Query: 159 YSSFVYLRALEKRYVNVDVWMMMEYGVEASWTKIYAI 49 + Y R + + ++D+W+M +YGV SW K + + Sbjct: 288 CFTENYPREM-LVHQSIDIWVMKKYGVRESWIKEFTV 323 >ref|XP_006447718.1| hypothetical protein CICLE_v10015458mg [Citrus clementina] gi|568830515|ref|XP_006469543.1| PREDICTED: F-box protein At3g07870-like [Citrus sinensis] gi|557550329|gb|ESR60958.1| hypothetical protein CICLE_v10015458mg [Citrus clementina] Length = 405 Score = 56.2 bits (134), Expect = 7e-06 Identities = 37/106 (34%), Positives = 50/106 (47%), Gaps = 3/106 (2%) Frame = -3 Query: 318 GCYHWMARCED-RSYNALSFSFDDESFKLIAGPPTAPRRTLGDVFVLHHHLTFIYSSFVY 142 G HW A D R+ SF DE F+ GPPT R ++ + F+Y Sbjct: 230 GALHWYAHSHDKRTAFMCSFDLGDEQFRQFPGPPT---REYDKCRPINSISVGVSGGFLY 286 Query: 141 L--RALEKRYVNVDVWMMMEYGVEASWTKIYAIDTDFVGNFWRLHG 10 L LE N+D+W+M +YGV+ SWTK + I V RL+G Sbjct: 287 LCDGFLEP---NLDIWIMKKYGVKESWTKEFVIVNSVVSKLQRLYG 329