BLASTX nr result
ID: Rheum21_contig00020667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00020667 (543 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ06247.1| hypothetical protein PRUPE_ppa004609mg [Prunus pe... 56 5e-06 ref|XP_002278434.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 >gb|EMJ06247.1| hypothetical protein PRUPE_ppa004609mg [Prunus persica] Length = 500 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 6/78 (7%) Frame = +2 Query: 323 AGSSGITSLGKLGFSSRQRKF------SVESCPRVSISLIGNQNSKFIVPIRCKTKDFRL 484 A + G+ SL F+ ++++F S +SC RV + +Q FIV K +DFRL Sbjct: 2 ASAQGLASLTHSLFAVKRQRFMGLRGFSAQSCGRVFPRICKHQKPNFIVAKSSKVRDFRL 61 Query: 485 FQSVQQDRFVTSVDEDEM 538 F+SV+ D+F+TS DEDEM Sbjct: 62 FKSVELDQFLTSDDEDEM 79 >ref|XP_002278434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Vitis vinifera] Length = 511 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/55 (50%), Positives = 40/55 (72%) Frame = +2 Query: 377 RKFSVESCPRVSISLIGNQNSKFIVPIRCKTKDFRLFQSVQQDRFVTSVDEDEMS 541 R F E C R + ++ +QN +F+VP R K ++FRLF+SV+ D+F+TS DEDEMS Sbjct: 39 RSFLGEYCSRAT-TICNHQNPRFVVPKRDKIREFRLFKSVELDQFLTSDDEDEMS 92