BLASTX nr result
ID: Rheum21_contig00020560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00020560 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY24172.1| Cationic amino acid transporter, putative [Theobr... 86 5e-15 ref|XP_004300325.1| PREDICTED: cationic amino acid transporter 6... 82 1e-13 gb|EMJ11783.1| hypothetical protein PRUPE_ppa015187mg [Prunus pe... 78 1e-12 ref|XP_003635611.1| PREDICTED: high affinity cationic amino acid... 78 1e-12 emb|CBI14847.3| unnamed protein product [Vitis vinifera] 78 1e-12 ref|XP_002531231.1| cationic amino acid transporter, putative [R... 77 2e-12 ref|XP_004162422.1| PREDICTED: cationic amino acid transporter 6... 77 3e-12 ref|XP_004148384.1| PREDICTED: cationic amino acid transporter 6... 77 3e-12 ref|XP_006385572.1| hypothetical protein POPTR_0003s08200g [Popu... 76 5e-12 emb|CAN83060.1| hypothetical protein VITISV_010305 [Vitis vinifera] 76 5e-12 ref|XP_006477566.1| PREDICTED: cationic amino acid transporter 6... 75 7e-12 ref|XP_006440163.1| hypothetical protein CICLE_v10019477mg [Citr... 75 7e-12 ref|XP_006368941.1| hypothetical protein POPTR_0001s150801g, par... 75 7e-12 ref|XP_006385370.1| hypothetical protein POPTR_0003s031602g, par... 75 7e-12 ref|XP_004508965.1| PREDICTED: cationic amino acid transporter 6... 75 1e-11 gb|ESW27713.1| hypothetical protein PHAVU_003G225700g [Phaseolus... 72 6e-11 ref|XP_006283404.1| hypothetical protein CARUB_v10004452mg [Caps... 72 6e-11 ref|XP_003525587.1| PREDICTED: cationic amino acid transporter 6... 72 6e-11 gb|ESW28585.1| hypothetical protein PHAVU_002G001800g [Phaseolus... 72 1e-10 ref|XP_003549952.1| PREDICTED: cationic amino acid transporter 6... 71 2e-10 >gb|EOY24172.1| Cationic amino acid transporter, putative [Theobroma cacao] Length = 603 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/71 (60%), Positives = 51/71 (71%) Frame = -3 Query: 215 LRILEKPRKLLLQYFTGMENGNPAESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQ 36 LR+L + K L+ FT M P + F NYL SLSQTP RL++RMLATWTPD+ELN Sbjct: 14 LRLLIESHKTLIS-FTNMATIQPTHNKVFFFNYLQSLSQTPRRLRKRMLATWTPDQELNH 72 Query: 35 VRMRSGADMKR 3 VR+RSGADMKR Sbjct: 73 VRLRSGADMKR 83 >ref|XP_004300325.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 583 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -3 Query: 152 NPAESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 N +N F NYLHSLSQTP RL++RMLATWTPD+ELNQVR RSGADMKR Sbjct: 13 NNTNTNLSFSNYLHSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKR 62 >gb|EMJ11783.1| hypothetical protein PRUPE_ppa015187mg [Prunus persica] Length = 580 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -3 Query: 170 TGMENGNPAESNTI-FHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 T + P + TI F YLHSLSQTP RL++RMLATWTPD+ELNQVR RSGADMKR Sbjct: 3 TTTQTSAPNNTTTICFSKYLHSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKR 59 >ref|XP_003635611.1| PREDICTED: high affinity cationic amino acid transporter 1-like, partial [Vitis vinifera] Length = 255 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 146 AESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 A S+ F NYLHSLSQTP RL++RMLATWT D+ELNQVR+RSGADMKR Sbjct: 7 ALSSIFFSNYLHSLSQTPHRLRKRMLATWTSDQELNQVRLRSGADMKR 54 >emb|CBI14847.3| unnamed protein product [Vitis vinifera] Length = 223 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 146 AESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 A S+ F NYLHSLSQTP RL++RMLATWT D+ELNQVR+RSGADMKR Sbjct: 7 ALSSIFFSNYLHSLSQTPHRLRKRMLATWTSDQELNQVRLRSGADMKR 54 >ref|XP_002531231.1| cationic amino acid transporter, putative [Ricinus communis] gi|223529191|gb|EEF31167.1| cationic amino acid transporter, putative [Ricinus communis] Length = 584 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 140 SNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +++ F +YLHSLSQTP RLK+RMLATWTP +ELNQVR+RSGADMKR Sbjct: 18 ASSFFSDYLHSLSQTPYRLKKRMLATWTPAQELNQVRLRSGADMKR 63 >ref|XP_004162422.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Cucumis sativus] Length = 586 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 146 AESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 A S+T YL+SLSQTP RL++RMLATWTPD+ELNQVR RSGADMKR Sbjct: 4 AVSSTFLRRYLYSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKR 51 >ref|XP_004148384.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Cucumis sativus] Length = 570 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 146 AESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 A S+T YL+SLSQTP RL++RMLATWTPD+ELNQVR RSGADMKR Sbjct: 4 AVSSTFLRRYLYSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKR 51 >ref|XP_006385572.1| hypothetical protein POPTR_0003s08200g [Populus trichocarpa] gi|550342699|gb|ERP63369.1| hypothetical protein POPTR_0003s08200g [Populus trichocarpa] Length = 573 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 140 SNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +N F NYL SLSQTP RL++RMLATWTPD+ELNQVR+RSGADM R Sbjct: 9 TNVSFSNYLQSLSQTPHRLRKRMLATWTPDQELNQVRLRSGADMMR 54 >emb|CAN83060.1| hypothetical protein VITISV_010305 [Vitis vinifera] Length = 591 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 146 AESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 A S+ F YLHSLSQTP RL++RMLATWT D+ELNQVR+RSGADMKR Sbjct: 7 ALSSIFFSKYLHSLSQTPHRLRKRMLATWTSDQELNQVRLRSGADMKR 54 >ref|XP_006477566.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Citrus sinensis] Length = 576 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -3 Query: 152 NPAESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +P +N F YL SL+QTP RL++RMLATWTPD+ELN+VR+RSGADMKR Sbjct: 8 SPIATNIFFTKYLQSLTQTPHRLRKRMLATWTPDQELNRVRLRSGADMKR 57 >ref|XP_006440163.1| hypothetical protein CICLE_v10019477mg [Citrus clementina] gi|557542425|gb|ESR53403.1| hypothetical protein CICLE_v10019477mg [Citrus clementina] Length = 576 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -3 Query: 152 NPAESNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +P +N F YL SL+QTP RL++RMLATWTPD+ELN+VR+RSGADMKR Sbjct: 8 SPIATNIFFTKYLQSLTQTPHRLRKRMLATWTPDQELNRVRLRSGADMKR 57 >ref|XP_006368941.1| hypothetical protein POPTR_0001s150801g, partial [Populus trichocarpa] gi|550347300|gb|ERP65510.1| hypothetical protein POPTR_0001s150801g, partial [Populus trichocarpa] Length = 201 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 140 SNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +N F NYL SLSQTP RL++RMLATWTPD+ELNQVR+RSGADM R Sbjct: 9 TNISFSNYLQSLSQTPHRLRKRMLATWTPDQELNQVRLRSGADMMR 54 >ref|XP_006385370.1| hypothetical protein POPTR_0003s031602g, partial [Populus trichocarpa] gi|550342312|gb|ERP63167.1| hypothetical protein POPTR_0003s031602g, partial [Populus trichocarpa] Length = 129 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 140 SNTIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +N F NYL SLSQTP RL++RMLATWTPD+ELNQVR+RSGADM R Sbjct: 9 TNISFSNYLQSLSQTPHRLRKRMLATWTPDQELNQVRLRSGADMMR 54 >ref|XP_004508965.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Cicer arietinum] Length = 575 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -3 Query: 134 TIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 T+ NYL+SLSQTP RL++RMLATWTPD+E NQVR RSGADMKR Sbjct: 2 TMLSNYLYSLSQTPHRLRKRMLATWTPDQEFNQVRQRSGADMKR 45 >gb|ESW27713.1| hypothetical protein PHAVU_003G225700g [Phaseolus vulgaris] Length = 585 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 122 NYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +YLHSLSQTP RL++RMLATWTPD+E NQVR RSGADMKR Sbjct: 16 SYLHSLSQTPHRLRKRMLATWTPDQEFNQVRHRSGADMKR 55 >ref|XP_006283404.1| hypothetical protein CARUB_v10004452mg [Capsella rubella] gi|482552109|gb|EOA16302.1| hypothetical protein CARUB_v10004452mg [Capsella rubella] Length = 580 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 119 YLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 Y HSLSQTP RLK RMLATWTPD+E+NQVR+RSGADMKR Sbjct: 4 YFHSLSQTPHRLKSRMLATWTPDQEVNQVRLRSGADMKR 42 >ref|XP_003525587.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Glycine max] Length = 575 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 122 NYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +YLHSLSQTP RL++RMLATWTPD+E NQVR RSGADMKR Sbjct: 16 SYLHSLSQTPHRLRKRMLATWTPDQEFNQVRHRSGADMKR 55 >gb|ESW28585.1| hypothetical protein PHAVU_002G001800g [Phaseolus vulgaris] Length = 577 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/51 (72%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -3 Query: 152 NPAESN-TIFHNYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 N A +N T Y HSLSQTP RLK+RMLAT TPD+ELNQVR RSGADMKR Sbjct: 3 NTATNNKTTLSGYFHSLSQTPQRLKKRMLATGTPDQELNQVRQRSGADMKR 53 >ref|XP_003549952.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Glycine max] Length = 573 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -3 Query: 122 NYLHSLSQTPLRLKRRMLATWTPDEELNQVRMRSGADMKR 3 +YLHSLSQTP RL++RMLATWTP++E NQVR RSGADMKR Sbjct: 16 SYLHSLSQTPHRLRKRMLATWTPEQEFNQVRHRSGADMKR 55