BLASTX nr result
ID: Rheum21_contig00020194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00020194 (247 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD05854.1| putative ATP synthase epsilon chain, mitochondri... 61 2e-07 gb|EXC31003.1| ATP synthase subunit epsilon [Morus notabilis] 57 2e-06 ref|XP_006362106.1| PREDICTED: ATP synthase subunit epsilon, mit... 56 4e-06 ref|XP_006342867.1| PREDICTED: ATP synthase subunit epsilon, mit... 55 1e-05 >dbj|BAD05854.1| putative ATP synthase epsilon chain, mitochondrial [Oryza sativa Japonica Group] Length = 104 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 245 EPHRSEALSKEKVHYAISKWEDGKPQKPNLGFMDRRDRG 129 EPH+SEA S+EKVH+AISKW DGK +KPNLG ++ R G Sbjct: 35 EPHKSEAASREKVHFAISKWADGKQEKPNLGSVESRKDG 73 >gb|EXC31003.1| ATP synthase subunit epsilon [Morus notabilis] Length = 287 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -3 Query: 245 EPHRSEALSKEKVHYAISKWEDGKPQKP 162 EPH+SEALS+EKVH+A+SKW DGKPQKP Sbjct: 34 EPHKSEALSREKVHFAVSKWADGKPQKP 61 >ref|XP_006362106.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Solanum tuberosum] Length = 70 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 245 EPHRSEALSKEKVHYAISKWEDGKPQKPNL 156 EP+++EALS+EKVHY+ISKW DGKPQKP L Sbjct: 34 EPYKAEALSREKVHYSISKWADGKPQKPTL 63 >ref|XP_006342867.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Solanum tuberosum] Length = 70 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 245 EPHRSEALSKEKVHYAISKWEDGKPQKPNL 156 EP++SEAL++EKVHY ISKW DGKPQKP + Sbjct: 34 EPYKSEALTREKVHYTISKWADGKPQKPTI 63