BLASTX nr result
ID: Rheum21_contig00020060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00020060 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535531.1| PREDICTED: endoplasmic reticulum metallopept... 56 6e-06 ref|XP_004237245.1| PREDICTED: endoplasmic reticulum metallopept... 55 7e-06 ref|XP_004237244.1| PREDICTED: endoplasmic reticulum metallopept... 55 7e-06 >ref|XP_003535531.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform X1 [Glycine max] gi|571484023|ref|XP_006589429.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform X2 [Glycine max] gi|571484025|ref|XP_006589430.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform X3 [Glycine max] Length = 912 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 114 KYVMTAAEIIKNTSYWEVDVEVEHFHVKSGATHLQGGL 1 +YV+TA E IK T+ WEVDVEV+ FH KSGA HL+ GL Sbjct: 114 QYVLTACENIKKTALWEVDVEVDLFHAKSGANHLRSGL 151 >ref|XP_004237245.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 2 [Solanum lycopersicum] Length = 836 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 114 KYVMTAAEIIKNTSYWEVDVEVEHFHVKSGATHLQGGL 1 +YV+ AAE IK T++WEVDVE++ FH KSGA H+ GGL Sbjct: 90 QYVLQAAENIKETAHWEVDVELDLFHAKSGANHMVGGL 127 >ref|XP_004237244.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 1 [Solanum lycopersicum] Length = 891 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 114 KYVMTAAEIIKNTSYWEVDVEVEHFHVKSGATHLQGGL 1 +YV+ AAE IK T++WEVDVE++ FH KSGA H+ GGL Sbjct: 90 QYVLQAAENIKETAHWEVDVELDLFHAKSGANHMVGGL 127