BLASTX nr result
ID: Rheum21_contig00019970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00019970 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309757.2| hypothetical protein POPTR_0007s01210g [Popu... 62 1e-07 ref|XP_002523984.1| leucine-rich repeat containing protein, puta... 60 2e-07 gb|EOY10377.1| Leucine-rich repeat containing protein, putative ... 59 7e-07 >ref|XP_002309757.2| hypothetical protein POPTR_0007s01210g [Populus trichocarpa] gi|550333876|gb|EEE90207.2| hypothetical protein POPTR_0007s01210g [Populus trichocarpa] Length = 1304 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/86 (40%), Positives = 47/86 (54%), Gaps = 8/86 (9%) Frame = -1 Query: 234 DNTGEILPQVHNTTKLRSFMLMIEGWDVD-----QQLRGNKWLRALSLSGVGFV---DVP 79 D +I +H LR+F+L+ GW D LR K LR LS G G++ +P Sbjct: 540 DQVSKIFEHIHEVQHLRNFLLVAPGWKADGKVLHDMLRILKRLRVLSFVGSGYIHQFQLP 599 Query: 78 SCIGELKLLRYLDLSQNDFERLPDSV 1 + IG LK LRYLDLS ERLP+++ Sbjct: 600 NSIGNLKHLRYLDLSGKSIERLPENM 625 >ref|XP_002523984.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223536711|gb|EEF38352.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1143 Score = 60.5 bits (145), Expect = 2e-07 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 5/104 (4%) Frame = -1 Query: 297 MQTKPSSQYHSARHVHIGCGPDNTGEILPQVHNTTKLRSFMLMIE-----GWDVDQQLRG 133 M + Q + RHV + C + + + HN+ KLR+ +L E G +DQ Sbjct: 506 MSSFQPEQCQNWRHVSLLC-QNVEAQSMEIAHNSKKLRTLLLPREHLKNFGQALDQLFHS 564 Query: 132 NKWLRALSLSGVGFVDVPSCIGELKLLRYLDLSQNDFERLPDSV 1 +++RAL LS +++P I E KLLRYLDLSQ + LPDS+ Sbjct: 565 LRYIRALDLSSSTLLELPGSIKECKLLRYLDLSQTEIRVLPDSI 608 >gb|EOY10377.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718481|gb|EOY10378.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718482|gb|EOY10379.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] Length = 1156 Score = 58.9 bits (141), Expect = 7e-07 Identities = 36/92 (39%), Positives = 53/92 (57%), Gaps = 5/92 (5%) Frame = -1 Query: 261 RHVHIGCGPDNTGEILPQVHNTTKLRSFMLMIE-----GWDVDQQLRGNKWLRALSLSGV 97 RHV + G D L + +TKLR+ +L E G +D+ K++R L+LS Sbjct: 527 RHVSL-LGQDVENPTLQIIERSTKLRTLLLPGESLKNLGQALDKMFHSLKYIRVLNLSSS 585 Query: 96 GFVDVPSCIGELKLLRYLDLSQNDFERLPDSV 1 F ++PS I LKLLRYLDLS+ + + LP+S+ Sbjct: 586 SFSELPSSIENLKLLRYLDLSRTEIKVLPNSI 617