BLASTX nr result
ID: Rheum21_contig00019447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00019447 (416 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484319.1| PREDICTED: uncharacterized protein LOC102617... 58 1e-06 ref|XP_002265114.1| PREDICTED: uncharacterized protein LOC100267... 56 6e-06 >ref|XP_006484319.1| PREDICTED: uncharacterized protein LOC102617215 [Citrus sinensis] Length = 477 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -1 Query: 374 MEAPSVRKLCKQLISLAIQRCRLSADLCRLSVDIRRSQAFDPQMIQIS 231 ME SV++LC LIS A QRCR+S DLCRLSV ++RS DP +++S Sbjct: 1 MEVSSVQRLCLHLISAAFQRCRVSEDLCRLSVVLKRSSDSDPSTVRVS 48 >ref|XP_002265114.1| PREDICTED: uncharacterized protein LOC100267199 [Vitis vinifera] Length = 456 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -1 Query: 362 SVRKLCKQLISLAIQRCRLSADLCRLSVDIRRSQAFDPQMIQIS 231 SV KLC LIS AIQRCR+S DLCRLSV ++RS DP ++ IS Sbjct: 6 SVPKLCLHLISSAIQRCRMSEDLCRLSVVLKRSPVSDPPILGIS 49