BLASTX nr result
ID: Rheum21_contig00019229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00019229 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535070.1| conserved hypothetical protein [Ricinus comm... 71 2e-10 ref|XP_002536345.1| conserved hypothetical protein [Ricinus comm... 71 2e-10 ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 ... 68 1e-09 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 66 4e-09 gb|ESW10375.1| hypothetical protein PHAVU_009G203800g [Phaseolus... 60 3e-07 >ref|XP_002535070.1| conserved hypothetical protein [Ricinus communis] gi|223524097|gb|EEF27311.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 94 RKANCLLAGSCMSGNVHVRLREKGGGQKWPC 2 RKANCLLAGSCMSGNVHVR REKGGGQKWPC Sbjct: 63 RKANCLLAGSCMSGNVHVRFREKGGGQKWPC 93 >ref|XP_002536345.1| conserved hypothetical protein [Ricinus communis] gi|223520024|gb|EEF26037.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 94 RKANCLLAGSCMSGNVHVRLREKGGGQKWPC 2 RKANCLLAGSCMSGNVHVR REKGGGQKWPC Sbjct: 1 RKANCLLAGSCMSGNVHVRFREKGGGQKWPC 31 >ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] gi|241947412|gb|EES20557.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] Length = 58 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 14 LSTALLTKPYVDVTAHTAPSQQAVSLPLKRMEVWMNRHQ 130 +S LLT+PYVDVTAHTAPSQQAVS PL+ MEVW+NRHQ Sbjct: 6 ISVHLLTEPYVDVTAHTAPSQQAVSFPLEVMEVWINRHQ 44 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 94 RKANCLLAGSCMSGNVHVRLREKGGGQKWPC 2 R+A+CL AGSCMSGNVHVRLREKGGGQKWPC Sbjct: 24 READCLPAGSCMSGNVHVRLREKGGGQKWPC 54 >gb|ESW10375.1| hypothetical protein PHAVU_009G203800g [Phaseolus vulgaris] Length = 140 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 8 PFLSTALLTKPYVDVTAHTAPSQQAVSLPLKR 103 PFLSTALLT+PYVDVT HTAPS+QAVSLPL+R Sbjct: 15 PFLSTALLTEPYVDVTVHTAPSRQAVSLPLQR 46