BLASTX nr result
ID: Rheum21_contig00019189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00019189 (246 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001267902.1| KUP1 [Vitis vinifera] gi|93115179|gb|ABE9825... 101 1e-19 ref|XP_006359443.1| PREDICTED: potassium transporter 5-like [Sol... 100 3e-19 emb|CBI32231.3| unnamed protein product [Vitis vinifera] 100 3e-19 emb|CBI32230.3| unnamed protein product [Vitis vinifera] 100 3e-19 ref|XP_002264655.1| PREDICTED: potassium transporter 5 [Vitis vi... 100 3e-19 ref|XP_004247444.1| PREDICTED: potassium transporter 5-like [Sol... 100 3e-19 ref|XP_003625895.1| Potassium transporter [Medicago truncatula] ... 100 3e-19 ref|XP_002320355.1| hypothetical protein POPTR_0014s12700g [Popu... 98 1e-18 ref|XP_004494354.1| PREDICTED: potassium transporter 5-like [Cic... 98 1e-18 ref|XP_002264737.1| PREDICTED: potassium transporter 5 [Vitis vi... 98 1e-18 ref|XP_006444267.1| hypothetical protein CICLE_v10018938mg [Citr... 96 5e-18 ref|XP_006438921.1| hypothetical protein CICLE_v10033923mg [Citr... 96 5e-18 ref|XP_006438922.1| hypothetical protein CICLE_v10033931mg [Citr... 96 6e-18 ref|XP_004309699.1| PREDICTED: potassium transporter 5-like [Fra... 95 8e-18 ref|XP_002265365.1| PREDICTED: potassium transporter 5-like [Vit... 95 8e-18 gb|EMJ01511.1| hypothetical protein PRUPE_ppa001648mg [Prunus pe... 95 1e-17 gb|EXB40824.1| Potassium transporter 5 [Morus notabilis] 94 1e-17 ref|XP_004136047.1| PREDICTED: potassium transporter 5-like [Cuc... 93 4e-17 emb|CBI32229.3| unnamed protein product [Vitis vinifera] 92 5e-17 ref|XP_002528844.1| Potassium transporter, putative [Ricinus com... 92 5e-17 >ref|NP_001267902.1| KUP1 [Vitis vinifera] gi|93115179|gb|ABE98259.1| KUP1 [Vitis vinifera] Length = 773 Score = 101 bits (251), Expect = 1e-19 Identities = 50/68 (73%), Positives = 58/68 (85%), Gaps = 3/68 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV VFRCVVRYGYTD+RSE+EPFER+LVERLK+F Sbjct: 593 FVSIKSLPISKVPMEERFLFRRVNPDDLYVFRCVVRYGYTDVRSEEEPFERLLVERLKEF 652 Query: 173 VREESFVS 196 +REE ++ Sbjct: 653 IREEMMMT 660 >ref|XP_006359443.1| PREDICTED: potassium transporter 5-like [Solanum tuberosum] Length = 759 Score = 100 bits (248), Expect = 3e-19 Identities = 48/69 (69%), Positives = 59/69 (85%), Gaps = 3/69 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV+ VFRC VRYGY D+R+E+EPFER+LVERLK+F Sbjct: 587 FVSVKSLPISKVPVEERFLFRRVKPSDLYVFRCAVRYGYNDVRNEEEPFERLLVERLKEF 646 Query: 173 VREESFVSM 199 +R++S +SM Sbjct: 647 IRDDSILSM 655 >emb|CBI32231.3| unnamed protein product [Vitis vinifera] Length = 751 Score = 100 bits (248), Expect = 3e-19 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 3/68 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV VFRCVVRYGYTD+RSE+EPFER+LVERLK+F Sbjct: 593 FVSIKSLPISKVPMEERFLFRRVNPDNLYVFRCVVRYGYTDVRSEEEPFERLLVERLKEF 652 Query: 173 VREESFVS 196 +RE+ ++ Sbjct: 653 IREDMMMT 660 >emb|CBI32230.3| unnamed protein product [Vitis vinifera] Length = 734 Score = 100 bits (248), Expect = 3e-19 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 7/88 (7%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV+ VFRCVVRYGYTD+R E+EPFER+LVERLK+F Sbjct: 593 FVSIKSLPISKVPVEERFLFRRVEPNDIYVFRCVVRYGYTDVRFEEEPFERLLVERLKEF 652 Query: 173 VREESFVSMLKRQ----EAHESCGVVEL 244 +R E ++ +K+ ++ GVV L Sbjct: 653 IRGEIMMTDVKKDIEVIDSAAQVGVVHL 680 >ref|XP_002264655.1| PREDICTED: potassium transporter 5 [Vitis vinifera] Length = 773 Score = 100 bits (248), Expect = 3e-19 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 3/68 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV VFRCVVRYGYTD+RSE+EPFER+LVERLK+F Sbjct: 593 FVSIKSLPISKVPMEERFLFRRVNPDNLYVFRCVVRYGYTDVRSEEEPFERLLVERLKEF 652 Query: 173 VREESFVS 196 +RE+ ++ Sbjct: 653 IREDMMMT 660 >ref|XP_004247444.1| PREDICTED: potassium transporter 5-like [Solanum lycopersicum] Length = 759 Score = 99.8 bits (247), Expect = 3e-19 Identities = 48/69 (69%), Positives = 59/69 (85%), Gaps = 3/69 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV+ VFRC VRYGY D+R+E+EPFER+LVERLK+F Sbjct: 587 FVSVKSLPISKVPIEERFLFRRVKPSDVYVFRCAVRYGYNDVRNEEEPFERLLVERLKEF 646 Query: 173 VREESFVSM 199 +R+ES +S+ Sbjct: 647 IRDESILSL 655 >ref|XP_003625895.1| Potassium transporter [Medicago truncatula] gi|355500910|gb|AES82113.1| Potassium transporter [Medicago truncatula] Length = 773 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 3/68 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRVQ K VFRCVVRYGYTD R+EQEPFE+++VERLK+F Sbjct: 603 FVSIKSLPISKVPVEERFLFRRVQPKELNVFRCVVRYGYTDTRNEQEPFEKIMVERLKEF 662 Query: 173 VREESFVS 196 + +E + S Sbjct: 663 IVKEYYWS 670 >ref|XP_002320355.1| hypothetical protein POPTR_0014s12700g [Populus trichocarpa] gi|222861128|gb|EEE98670.1| hypothetical protein POPTR_0014s12700g [Populus trichocarpa] Length = 774 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/68 (70%), Positives = 57/68 (83%), Gaps = 3/68 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS K+LPI KVPAEERFLFRRV+ K VFRCV RYGYTD+R+EQEPFE +LVE+LK+F Sbjct: 596 FVSIKTLPIGKVPAEERFLFRRVEPKELNVFRCVARYGYTDVRNEQEPFEGMLVEKLKEF 655 Query: 173 VREESFVS 196 +R E + S Sbjct: 656 IRNEHWFS 663 >ref|XP_004494354.1| PREDICTED: potassium transporter 5-like [Cicer arietinum] Length = 720 Score = 97.8 bits (242), Expect = 1e-18 Identities = 53/86 (61%), Positives = 68/86 (79%), Gaps = 5/86 (5%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRVQ K VF+CVVRYGYTD+R++QEPFE+ LVE LK+F Sbjct: 550 FVSIKSLPISKVPMEERFLFRRVQPKELNVFQCVVRYGYTDVRNKQEPFEKFLVETLKEF 609 Query: 173 VREESFVS--MLKRQEAHESCGVVEL 244 + +E++ S ML+ ++ E+ V EL Sbjct: 610 IVKENWWSQKMLQDGKSDENLNVDEL 635 >ref|XP_002264737.1| PREDICTED: potassium transporter 5 [Vitis vinifera] Length = 773 Score = 97.8 bits (242), Expect = 1e-18 Identities = 48/69 (69%), Positives = 58/69 (84%), Gaps = 3/69 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV+ VFRCVVRYGYTD+R E+EPFER+LVERLK+F Sbjct: 593 FVSIKSLPISKVPVEERFLFRRVEPNDIYVFRCVVRYGYTDVRFEEEPFERLLVERLKEF 652 Query: 173 VREESFVSM 199 +R E +++ Sbjct: 653 IRGEIMMTV 661 >ref|XP_006444267.1| hypothetical protein CICLE_v10018938mg [Citrus clementina] gi|568852483|ref|XP_006479905.1| PREDICTED: potassium transporter 5-like [Citrus sinensis] gi|557546529|gb|ESR57507.1| hypothetical protein CICLE_v10018938mg [Citrus clementina] Length = 778 Score = 95.9 bits (237), Expect = 5e-18 Identities = 49/86 (56%), Positives = 65/86 (75%), Gaps = 5/86 (5%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI KVPAEERFLFRRV+ + VFRCV RYGYTD R+E+EPFER+L+E+L++F Sbjct: 596 FVSIKSLPIGKVPAEERFLFRRVEPRELNVFRCVARYGYTDARNEEEPFERMLIEKLEEF 655 Query: 173 VREESFV--SMLKRQEAHESCGVVEL 244 ++E+ ++ + + E E V EL Sbjct: 656 IKEDLWLCQTTISNMEIAEGDQVDEL 681 >ref|XP_006438921.1| hypothetical protein CICLE_v10033923mg [Citrus clementina] gi|557541117|gb|ESR52161.1| hypothetical protein CICLE_v10033923mg [Citrus clementina] Length = 756 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/78 (57%), Positives = 62/78 (79%), Gaps = 3/78 (3%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVPA+ERF+FRRV+ K ++RCV RYGY D+R+++EPFER+LVE LK F Sbjct: 594 FVSIKSLPISKVPADERFIFRRVEPKELNMYRCVGRYGYMDVRNQEEPFERILVENLKQF 653 Query: 173 VREESFVSMLKRQEAHES 226 +R++ S ++ AH+S Sbjct: 654 IRDDYKFSPQSQESAHDS 671 >ref|XP_006438922.1| hypothetical protein CICLE_v10033931mg [Citrus clementina] gi|568858838|ref|XP_006482950.1| PREDICTED: potassium transporter 5-like [Citrus sinensis] gi|557541118|gb|ESR52162.1| hypothetical protein CICLE_v10033931mg [Citrus clementina] Length = 756 Score = 95.5 bits (236), Expect = 6e-18 Identities = 45/78 (57%), Positives = 61/78 (78%), Gaps = 3/78 (3%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVPA+ERF+FRRV+ K ++RCV RYGY D+R ++EPFER+LVE LK F Sbjct: 594 FVSIKSLPISKVPADERFIFRRVEPKELNMYRCVGRYGYMDVRDQEEPFERILVENLKQF 653 Query: 173 VREESFVSMLKRQEAHES 226 +R++ S ++ AH+S Sbjct: 654 IRDDYKFSPQSQESAHDS 671 >ref|XP_004309699.1| PREDICTED: potassium transporter 5-like [Fragaria vesca subsp. vesca] Length = 804 Score = 95.1 bits (235), Expect = 8e-18 Identities = 46/68 (67%), Positives = 57/68 (83%), Gaps = 3/68 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV+ + VFRCV RYGYTD+R+E EPFE +LVE+LKDF Sbjct: 604 FVSIKSLPISKVPMEERFLFRRVEPRELNVFRCVARYGYTDVRNENEPFEGLLVEKLKDF 663 Query: 173 VREESFVS 196 +R++ + S Sbjct: 664 IRDDFWQS 671 >ref|XP_002265365.1| PREDICTED: potassium transporter 5-like [Vitis vinifera] Length = 770 Score = 95.1 bits (235), Expect = 8e-18 Identities = 46/65 (70%), Positives = 55/65 (84%), Gaps = 3/65 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV VF+CVVRYGYTD+R E++PFER+LVERLK+F Sbjct: 593 FVSIKSLPISKVPVEERFLFRRVDPDDIYVFQCVVRYGYTDMRFEEDPFERLLVERLKEF 652 Query: 173 VREES 187 +RE + Sbjct: 653 IREHT 657 >gb|EMJ01511.1| hypothetical protein PRUPE_ppa001648mg [Prunus persica] Length = 786 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/68 (66%), Positives = 57/68 (83%), Gaps = 3/68 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV+ K VFRCV RYGYTD+R+E EPFE +LVE+LK+F Sbjct: 601 FVSIKSLPISKVPLEERFLFRRVEPKELNVFRCVARYGYTDVRNEHEPFEGLLVEKLKEF 660 Query: 173 VREESFVS 196 +++ ++S Sbjct: 661 IKDSFWIS 668 >gb|EXB40824.1| Potassium transporter 5 [Morus notabilis] Length = 805 Score = 94.4 bits (233), Expect = 1e-17 Identities = 44/64 (68%), Positives = 55/64 (85%), Gaps = 3/64 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV+ VFRCV RYGYTD+R+E EPFE++LVE+LKDF Sbjct: 613 FVSIKSLPISKVPPEERFLFRRVEPNDLHVFRCVARYGYTDVRNESEPFEKMLVEKLKDF 672 Query: 173 VREE 184 ++++ Sbjct: 673 IKDD 676 >ref|XP_004136047.1| PREDICTED: potassium transporter 5-like [Cucumis sativus] gi|449527221|ref|XP_004170611.1| PREDICTED: potassium transporter 5-like [Cucumis sativus] Length = 758 Score = 92.8 bits (229), Expect = 4e-17 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 3/64 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQS---KVFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVSFKSLPI+KVP EERFLFRRV+ VFRCVVRYGY D+ EQE FERVLVERLK F Sbjct: 604 FVSFKSLPISKVPMEERFLFRRVEPDDLNVFRCVVRYGYRDIIHEQESFERVLVERLKMF 663 Query: 173 VREE 184 + EE Sbjct: 664 IEEE 667 >emb|CBI32229.3| unnamed protein product [Vitis vinifera] Length = 728 Score = 92.4 bits (228), Expect = 5e-17 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 3/82 (3%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS KSLPI+KVP EERFLFRRV VFRCVVRYGYTD+RSE+EPFER+LVERLK+ Sbjct: 593 FVSIKSLPISKVPMEERFLFRRVNPDDLYVFRCVVRYGYTDVRSEEEPFERLLVERLKE- 651 Query: 173 VREESFVSMLKRQEAHESCGVV 238 R+E ++ + GVV Sbjct: 652 -RQEDVDKDIEAIDRAARAGVV 672 >ref|XP_002528844.1| Potassium transporter, putative [Ricinus communis] gi|223531695|gb|EEF33518.1| Potassium transporter, putative [Ricinus communis] Length = 780 Score = 92.4 bits (228), Expect = 5e-17 Identities = 44/68 (64%), Positives = 55/68 (80%), Gaps = 3/68 (4%) Frame = +2 Query: 2 FVSFKSLPINKVPAEERFLFRRVQSK---VFRCVVRYGYTDLRSEQEPFERVLVERLKDF 172 FVS K LPI KVP EERFLFRRV+ K VFRCV RYGY D+R+EQEPFER+L+E+LK F Sbjct: 600 FVSIKWLPIGKVPVEERFLFRRVEPKELNVFRCVARYGYADVRNEQEPFERILIEKLKQF 659 Query: 173 VREESFVS 196 + ++ ++S Sbjct: 660 IIDDFWLS 667