BLASTX nr result
ID: Rheum21_contig00019001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00019001 (463 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276761.1| PREDICTED: FH protein interacting protein FI... 55 7e-06 >ref|XP_002276761.1| PREDICTED: FH protein interacting protein FIP2 [Vitis vinifera] gi|296085912|emb|CBI31236.3| unnamed protein product [Vitis vinifera] Length = 302 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/53 (50%), Positives = 38/53 (71%) Frame = -3 Query: 419 SSFIGNNANGEHF*HILKWLRE*VVPTLLLSEYYELMWEAKYYKLLVMKIGTG 261 + ++ + +G+HF HIL WLR+ VVPTL SEY EL+ EA+YY+LL + G G Sbjct: 51 NGYVFVDRDGKHFRHILNWLRDGVVPTLKDSEYSELLREAEYYQLLGLIAGIG 103