BLASTX nr result
ID: Rheum21_contig00018563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00018563 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519596.1| conserved hypothetical protein [Ricinus comm... 45 3e-07 >ref|XP_002519596.1| conserved hypothetical protein [Ricinus communis] gi|223541228|gb|EEF42782.1| conserved hypothetical protein [Ricinus communis] Length = 177 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 22/48 (45%), Positives = 29/48 (60%) Frame = -2 Query: 264 LHAGTTLSLITRCILAFKKGNLDDQHEPIVHPRCLITTASLGVIINHG 121 L+ GT LSL+ L K + DQ E + H RCL+ T+SL VII+ G Sbjct: 96 LNEGTPLSLVAHRALTVKDASAGDQRENLFHTRCLVGTSSLSVIIDSG 143 Score = 35.4 bits (80), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 118 SCCNMVTKKVANHLSLPIAPPPQPHGLQSIA 26 SCCN++ +KV L+LP +P PQ + LQ I+ Sbjct: 144 SCCNILNEKVVRVLNLPTSPHPQLYSLQWIS 174