BLASTX nr result
ID: Rheum21_contig00017264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00017264 (373 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB68165.1| Putative disease resistance protein RGA1 [Morus n... 58 1e-06 >gb|EXB68165.1| Putative disease resistance protein RGA1 [Morus notabilis] Length = 1108 Score = 58.2 bits (139), Expect = 1e-06 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 3/117 (2%) Frame = +3 Query: 27 FFPSLEALLLETMPKLRSWWVRAPT---VLPKCPRVTKVKIKDCPELEAAGMPLFPLVEV 197 FFP L+ L L +PKL+ WW + LP PR++K+ ++DCP+L++ MPLFP Sbjct: 851 FFPDLQELWLTELPKLQGWWKPSSVSQEYLPSFPRLSKLVVEDCPKLDS--MPLFP---T 905 Query: 198 LELTRVQEEVVWHGIGTPPQESTSVLKKCEIFSMGEAQLQHLSALRILVIYNCEELE 368 LE V + W+ + + K ++ S +Q LS L+ L I E + Sbjct: 906 LEDGLVLDSTCWNPFQLTMKHRAAATKN-KVSSSTSSQSTPLSKLKKLCIVGIPEFD 961