BLASTX nr result
ID: Rheum21_contig00016870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00016870 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGV29480.1| putative NAC domain class transcription factor [T... 64 3e-08 gb|AGV29486.1| putative NAC domain class transcription factor [T... 63 5e-08 >gb|AGV29480.1| putative NAC domain class transcription factor [Tamarix hispida] Length = 367 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/63 (49%), Positives = 47/63 (74%), Gaps = 2/63 (3%) Frame = +2 Query: 2 VNVVLSFDLPEGIFVNPAGMKALTGMISQKMTSVISRDWAY--FFSVMLVFMSAKVGSCI 175 VNVVLSF +PE + V+P G+K L+G++ K S +SR W Y FF V+++ ++AK+G+CI Sbjct: 306 VNVVLSFAVPESV-VSPVGLKYLSGVLGGKAASAVSRGWFYFLFFWVLVLAITAKIGTCI 364 Query: 176 YAR 184 YA+ Sbjct: 365 YAK 367 >gb|AGV29486.1| putative NAC domain class transcription factor [Tamarix hispida] Length = 185 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 2/63 (3%) Frame = +2 Query: 2 VNVVLSFDLPEGIFVNPAGMKALTGMISQKMTSVISRDW--AYFFSVMLVFMSAKVGSCI 175 VNVVLSF++PE + V P G+ L+GM+S K S ++R W +FF V+L+ +S K+G+CI Sbjct: 124 VNVVLSFNVPESV-VGPVGLDHLSGMLSGKAASTVARGWFGFFFFLVLLLAISVKMGTCI 182 Query: 176 YAR 184 YA+ Sbjct: 183 YAK 185