BLASTX nr result
ID: Rheum21_contig00016782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00016782 (310 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 67 2e-09 ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|AB... 56 6e-06 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -1 Query: 220 RDVAQLGSAFVLGTKCHGFKSCHPYLLLFL*EVKRN*LRS 101 RDVAQLGSAFVLGTKCHGFKSCHPYLLL V +N +RS Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLKRAVSQNKVRS 40 >ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|ABP35351.1| ORF66a [Pinus koraiensis] Length = 66 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 226 IKRDVAQLGSAFVLGTKCHGFKSCHPYLLL 137 I+RDVAQLGS FVLGTKC FKSCHPYL L Sbjct: 2 IRRDVAQLGSVFVLGTKCRRFKSCHPYLSL 31