BLASTX nr result
ID: Rheum21_contig00016585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00016585 (233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB61345.1| Geranylgeranyl transferase type-2 subunit beta [M... 62 8e-08 gb|EXC04276.1| Geranylgeranyl transferase type-2 subunit beta [M... 62 1e-07 ref|XP_006399737.1| hypothetical protein EUTSA_v10014116mg [Eutr... 62 1e-07 ref|XP_004235781.1| PREDICTED: geranylgeranyl transferase type-2... 61 1e-07 ref|XP_006407374.1| hypothetical protein EUTSA_v10021168mg [Eutr... 61 2e-07 gb|EOY19312.1| RAB geranylgeranyl transferase beta subunit 1 [Th... 60 2e-07 ref|XP_006288088.1| hypothetical protein CARUB_v10001318mg [Caps... 60 2e-07 ref|XP_006288087.1| hypothetical protein CARUB_v10001318mg [Caps... 60 2e-07 ref|XP_004307130.1| PREDICTED: geranylgeranyl transferase type-2... 60 2e-07 ref|XP_004293481.1| PREDICTED: geranylgeranyl transferase type-2... 60 2e-07 dbj|BAB10039.1| Rab geranylgeranyltransferase, beta subunit [Ara... 60 3e-07 ref|XP_006341512.1| PREDICTED: geranylgeranyl transferase type-2... 60 3e-07 ref|XP_006341511.1| PREDICTED: geranylgeranyl transferase type-2... 60 3e-07 ref|XP_006341510.1| PREDICTED: geranylgeranyl transferase type-2... 60 3e-07 ref|XP_006341509.1| PREDICTED: geranylgeranyl transferase type-2... 60 3e-07 gb|EMJ16910.1| hypothetical protein PRUPE_ppa008926mg [Prunus pe... 60 3e-07 ref|NP_974770.1| RAB geranylgeranyl transferase beta subunit 1 [... 60 3e-07 ref|NP_568259.1| RAB geranylgeranyl transferase beta subunit 1 [... 60 3e-07 ref|XP_002871518.1| beta subunit of rab geranylgeranyltransferas... 60 3e-07 ref|XP_003524939.2| PREDICTED: LOW QUALITY PROTEIN: geranylgeran... 59 7e-07 >gb|EXB61345.1| Geranylgeranyl transferase type-2 subunit beta [Morus notabilis] Length = 372 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLII 104 FGVAGLSLLE+PG+KAIDPAYALP DVVNR+ ++ Sbjct: 338 FGVAGLSLLEYPGLKAIDPAYALPVDVVNRIFLL 371 >gb|EXC04276.1| Geranylgeranyl transferase type-2 subunit beta [Morus notabilis] Length = 372 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FGVAGLSLLE+PG+KAIDPAYALP DVVNR+ + Sbjct: 338 FGVAGLSLLEYPGVKAIDPAYALPVDVVNRIFL 370 >ref|XP_006399737.1| hypothetical protein EUTSA_v10014116mg [Eutrema salsugineum] gi|557100827|gb|ESQ41190.1| hypothetical protein EUTSA_v10014116mg [Eutrema salsugineum] Length = 322 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVL 98 FGVAGLSLLE+PGIKAIDPAYALP DV+NR++ Sbjct: 288 FGVAGLSLLEYPGIKAIDPAYALPVDVINRII 319 >ref|XP_004235781.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Solanum lycopersicum] Length = 313 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FGVAGLSLLE+PGIK IDPAYALP DVVNRV++ Sbjct: 279 FGVAGLSLLEYPGIKPIDPAYALPVDVVNRVML 311 >ref|XP_006407374.1| hypothetical protein EUTSA_v10021168mg [Eutrema salsugineum] gi|567200262|ref|XP_006407375.1| hypothetical protein EUTSA_v10021168mg [Eutrema salsugineum] gi|557108520|gb|ESQ48827.1| hypothetical protein EUTSA_v10021168mg [Eutrema salsugineum] gi|557108521|gb|ESQ48828.1| hypothetical protein EUTSA_v10021168mg [Eutrema salsugineum] Length = 314 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FGVAGLSLLE+PG+K IDPAYALP DV+NR+L+ Sbjct: 280 FGVAGLSLLEYPGVKPIDPAYALPVDVINRILL 312 >gb|EOY19312.1| RAB geranylgeranyl transferase beta subunit 1 [Theobroma cacao] Length = 315 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRV 95 FGVAGLSLLE+PG+KAIDPAYALP DVVNR+ Sbjct: 279 FGVAGLSLLEYPGLKAIDPAYALPVDVVNRI 309 >ref|XP_006288088.1| hypothetical protein CARUB_v10001318mg [Capsella rubella] gi|482556794|gb|EOA20986.1| hypothetical protein CARUB_v10001318mg [Capsella rubella] Length = 347 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVL 98 FGVAGLSLLE+PG+K IDPAYALP DV+NR+L Sbjct: 313 FGVAGLSLLEYPGVKTIDPAYALPVDVINRIL 344 >ref|XP_006288087.1| hypothetical protein CARUB_v10001318mg [Capsella rubella] gi|482556793|gb|EOA20985.1| hypothetical protein CARUB_v10001318mg [Capsella rubella] Length = 346 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVL 98 FGVAGLSLLE+PG+K IDPAYALP DV+NR+L Sbjct: 312 FGVAGLSLLEYPGVKTIDPAYALPVDVINRIL 343 >ref|XP_004307130.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Fragaria vesca subsp. vesca] Length = 315 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FGVAGLSLLE+PG+K IDPAYALP DVVNR+++ Sbjct: 279 FGVAGLSLLEYPGVKPIDPAYALPVDVVNRIIL 311 >ref|XP_004293481.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Fragaria vesca subsp. vesca] Length = 319 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FGVAGLSLLE+PG+K IDPAYALP DVVNR+++ Sbjct: 279 FGVAGLSLLEYPGVKPIDPAYALPVDVVNRIIL 311 >dbj|BAB10039.1| Rab geranylgeranyltransferase, beta subunit [Arabidopsis thaliana] gi|21594047|gb|AAM65965.1| Rab geranylgeranyltransferase, beta subunit [Arabidopsis thaliana] Length = 313 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVL 98 FGVAGLSLLE+PG+K IDPAYALP DVVNR++ Sbjct: 279 FGVAGLSLLEYPGVKVIDPAYALPVDVVNRII 310 >ref|XP_006341512.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like isoform X4 [Solanum tuberosum] Length = 260 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FG+AGLSLLE+PGIK IDPAYALP DVVNRV++ Sbjct: 226 FGLAGLSLLEYPGIKPIDPAYALPVDVVNRVML 258 >ref|XP_006341511.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like isoform X3 [Solanum tuberosum] Length = 287 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FG+AGLSLLE+PGIK IDPAYALP DVVNRV++ Sbjct: 253 FGLAGLSLLEYPGIKPIDPAYALPVDVVNRVML 285 >ref|XP_006341510.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like isoform X2 [Solanum tuberosum] Length = 313 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FG+AGLSLLE+PGIK IDPAYALP DVVNRV++ Sbjct: 279 FGLAGLSLLEYPGIKPIDPAYALPVDVVNRVML 311 >ref|XP_006341509.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like isoform X1 [Solanum tuberosum] Length = 340 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FG+AGLSLLE+PGIK IDPAYALP DVVNRV++ Sbjct: 306 FGLAGLSLLEYPGIKPIDPAYALPVDVVNRVML 338 >gb|EMJ16910.1| hypothetical protein PRUPE_ppa008926mg [Prunus persica] Length = 314 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVLI 101 FGVAGLSLLE+PG+KAIDPAYALP DVV+R+++ Sbjct: 280 FGVAGLSLLEYPGLKAIDPAYALPVDVVDRIIL 312 >ref|NP_974770.1| RAB geranylgeranyl transferase beta subunit 1 [Arabidopsis thaliana] gi|332004392|gb|AED91775.1| RAB geranylgeranyl transferase beta subunit 1 [Arabidopsis thaliana] Length = 320 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVL 98 FGVAGLSLLE+PG+K IDPAYALP DVVNR++ Sbjct: 286 FGVAGLSLLEYPGVKVIDPAYALPVDVVNRII 317 >ref|NP_568259.1| RAB geranylgeranyl transferase beta subunit 1 [Arabidopsis thaliana] gi|28466947|gb|AAO44082.1| At5g12210 [Arabidopsis thaliana] gi|28466951|gb|AAO44084.1| At4g26580 [Arabidopsis thaliana] gi|110743899|dbj|BAE99784.1| Rab geranylgeranyltransferase, beta subunit [Arabidopsis thaliana] gi|332004391|gb|AED91774.1| RAB geranylgeranyl transferase beta subunit 1 [Arabidopsis thaliana] Length = 321 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVL 98 FGVAGLSLLE+PG+K IDPAYALP DVVNR++ Sbjct: 287 FGVAGLSLLEYPGVKVIDPAYALPVDVVNRII 318 >ref|XP_002871518.1| beta subunit of rab geranylgeranyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297317355|gb|EFH47777.1| beta subunit of rab geranylgeranyltransferase [Arabidopsis lyrata subsp. lyrata] Length = 313 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVL 98 FGVAGLSLLE+PG+K IDPAYALP DVVNR++ Sbjct: 279 FGVAGLSLLEYPGVKVIDPAYALPVDVVNRII 310 >ref|XP_003524939.2| PREDICTED: LOW QUALITY PROTEIN: geranylgeranyl transferase type-2 subunit beta-like [Glycine max] Length = 323 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 FGVAGLSLLEFPGIKAIDPAYALPADVVNRVL 98 FGVAGLSLLE+PG+K +DPAYALP DVVNR++ Sbjct: 286 FGVAGLSLLEYPGLKPVDPAYALPVDVVNRII 317