BLASTX nr result
ID: Rheum21_contig00016393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00016393 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23058.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_002274166.1| PREDICTED: metal-nicotianamine transporter Y... 69 5e-10 emb|CAN77891.1| hypothetical protein VITISV_016271 [Vitis vinifera] 69 5e-10 dbj|BAB11231.1| unnamed protein product [Arabidopsis thaliana] 68 1e-09 ref|XP_006287225.1| hypothetical protein CARUB_v10000403mg [Caps... 68 1e-09 gb|AAM98073.1| AT5g24380/K16H17_9 [Arabidopsis thaliana] gi|2902... 68 1e-09 ref|NP_197826.2| metal-nicotianamine transporter YSL2 [Arabidops... 68 1e-09 ref|XP_002872112.1| hypothetical protein ARALYDRAFT_489303 [Arab... 68 1e-09 dbj|BAH57276.1| AT5G24380 [Arabidopsis thaliana] 68 1e-09 dbj|BAE99250.1| hypothetical protein [Arabidopsis thaliana] 68 1e-09 gb|ESW08475.1| hypothetical protein PHAVU_009G048800g [Phaseolus... 68 1e-09 ref|XP_003602315.1| YSL transporter [Medicago truncatula] gi|355... 68 1e-09 ref|XP_006581667.1| PREDICTED: metal-nicotianamine transporter Y... 67 2e-09 ref|XP_002518903.1| oligopeptide transporter, putative [Ricinus ... 67 2e-09 ref|XP_006471126.1| PREDICTED: metal-nicotianamine transporter Y... 67 2e-09 ref|XP_006431856.1| hypothetical protein CICLE_v10003961mg [Citr... 67 2e-09 gb|EOY23662.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao] ... 67 2e-09 ref|XP_003556858.1| PREDICTED: metal-nicotianamine transporter Y... 67 2e-09 gb|ADE77032.1| unknown [Picea sitchensis] 67 2e-09 ref|XP_006350625.1| PREDICTED: metal-nicotianamine transporter Y... 67 3e-09 >emb|CBI23058.3| unnamed protein product [Vitis vinifera] Length = 649 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSSVLAL K+NPPICM+F A+ Sbjct: 613 PAVASGLICGDGLWILPSSVLALAKINPPICMSFLAT 649 >ref|XP_002274166.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Vitis vinifera] Length = 665 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSSVLAL K+NPPICM+F A+ Sbjct: 629 PAVASGLICGDGLWILPSSVLALAKINPPICMSFLAT 665 >emb|CAN77891.1| hypothetical protein VITISV_016271 [Vitis vinifera] Length = 677 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSSVLAL K+NPPICM+F A+ Sbjct: 641 PAVASGLICGDGLWILPSSVLALAKINPPICMSFLAT 677 >dbj|BAB11231.1| unnamed protein product [Arabidopsis thaliana] Length = 652 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL KV PPICM FTA+ Sbjct: 615 PAVASGLICGDGLWILPSSLLALAKVRPPICMNFTAA 651 >ref|XP_006287225.1| hypothetical protein CARUB_v10000403mg [Capsella rubella] gi|482555931|gb|EOA20123.1| hypothetical protein CARUB_v10000403mg [Capsella rubella] Length = 664 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL KV PPICM FTA+ Sbjct: 627 PAVASGLICGDGLWILPSSLLALAKVKPPICMNFTAA 663 >gb|AAM98073.1| AT5g24380/K16H17_9 [Arabidopsis thaliana] gi|29028724|gb|AAO64741.1| AT5g24380/K16H17_9 [Arabidopsis thaliana] Length = 409 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL KV PPICM FTA+ Sbjct: 372 PAVASGLICGDGLWILPSSLLALAKVRPPICMNFTAA 408 >ref|NP_197826.2| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana] gi|75291778|sp|Q6R3K9.1|YSL2_ARATH RecName: Full=Metal-nicotianamine transporter YSL2; AltName: Full=Protein YELLOW STRIPE LIKE 2; Short=AtYSL2 gi|41352039|gb|AAS00692.1| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana] gi|50080848|gb|AAT69741.1| putative metal-nicotianamine transporter [Arabidopsis thaliana] gi|332005922|gb|AED93305.1| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana] Length = 664 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL KV PPICM FTA+ Sbjct: 627 PAVASGLICGDGLWILPSSLLALAKVRPPICMNFTAA 663 >ref|XP_002872112.1| hypothetical protein ARALYDRAFT_489303 [Arabidopsis lyrata subsp. lyrata] gi|297317949|gb|EFH48371.1| hypothetical protein ARALYDRAFT_489303 [Arabidopsis lyrata subsp. lyrata] Length = 664 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL KV PPICM FTA+ Sbjct: 627 PAVASGLICGDGLWILPSSLLALAKVRPPICMNFTAA 663 >dbj|BAH57276.1| AT5G24380 [Arabidopsis thaliana] Length = 419 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL KV PPICM FTA+ Sbjct: 382 PAVASGLICGDGLWILPSSLLALAKVRPPICMNFTAA 418 >dbj|BAE99250.1| hypothetical protein [Arabidopsis thaliana] Length = 491 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL KV PPICM FTA+ Sbjct: 454 PAVASGLICGDGLWILPSSLLALAKVRPPICMNFTAA 490 >gb|ESW08475.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris] gi|561009569|gb|ESW08476.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris] Length = 673 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LALLKV PPICM+F ++ Sbjct: 634 PAVASGLICGDGLWILPSSILALLKVRPPICMSFLSA 670 >ref|XP_003602315.1| YSL transporter [Medicago truncatula] gi|355491363|gb|AES72566.1| YSL transporter [Medicago truncatula] Length = 841 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LALLKV PPICM+F S Sbjct: 651 PAVASGLICGDGLWILPSSILALLKVRPPICMSFFPS 687 >ref|XP_006581667.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X2 [Glycine max] gi|571460325|ref|XP_006581668.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X3 [Glycine max] gi|571460327|ref|XP_003527996.2| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X1 [Glycine max] Length = 676 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LALLK+ PPICM+F ++ Sbjct: 637 PAVASGLICGDGLWILPSSILALLKIRPPICMSFLSA 673 >ref|XP_002518903.1| oligopeptide transporter, putative [Ricinus communis] gi|223541890|gb|EEF43436.1| oligopeptide transporter, putative [Ricinus communis] Length = 667 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICG+GLW+LP++VLAL K+NPPICM F AS Sbjct: 631 PAVASGLICGEGLWTLPAAVLALAKINPPICMKFVAS 667 >ref|XP_006471126.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Citrus sinensis] Length = 673 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL K+ PPICM F AS Sbjct: 637 PAVASGLICGDGLWILPSSILALAKIRPPICMKFLAS 673 >ref|XP_006431856.1| hypothetical protein CICLE_v10003961mg [Citrus clementina] gi|557533978|gb|ESR45096.1| hypothetical protein CICLE_v10003961mg [Citrus clementina] Length = 673 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL K+ PPICM F AS Sbjct: 637 PAVASGLICGDGLWILPSSILALAKIRPPICMKFLAS 673 >gb|EOY23662.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao] gi|508776407|gb|EOY23663.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao] Length = 668 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PAVASGLICGDGLW LPSS+LAL KV PPICM F A+ Sbjct: 631 PAVASGLICGDGLWLLPSSILALFKVRPPICMNFLAT 667 >ref|XP_003556858.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Glycine max] Length = 670 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFTAS 199 PA ASGLICG+GLW+LP+S+LAL KVNPPICM F AS Sbjct: 634 PATASGLICGEGLWALPASILALAKVNPPICMNFLAS 670 >gb|ADE77032.1| unknown [Picea sitchensis] Length = 210 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTF 208 PAVASGLICGDG+W+LPSS+LAL KVNPPICM F Sbjct: 161 PAVASGLICGDGVWTLPSSILALAKVNPPICMKF 194 >ref|XP_006350625.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Solanum tuberosum] Length = 863 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 309 PAVASGLICGDGLWSLPSSVLALLKVNPPICMTFT 205 PAVASG ICGDGLW LPS+VLALLKV PPICM FT Sbjct: 649 PAVASGFICGDGLWILPSAVLALLKVRPPICMAFT 683