BLASTX nr result
ID: Rheum21_contig00016261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00016261 (818 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUD68213.1| hypothetical protein C922_01231 [Plasmodium inui ... 59 2e-06 >gb|EUD68213.1| hypothetical protein C922_01231 [Plasmodium inui San Antonio 1] Length = 2873 Score = 58.9 bits (141), Expect = 2e-06 Identities = 58/263 (22%), Positives = 111/263 (42%), Gaps = 2/263 (0%) Frame = +1 Query: 28 DRSDDTNDRERSHKQGLEVANNSQLTSGAVEDANGLIDDELKERNLIEVPDVELDNNHKD 207 D D+ + E + G+EV + E A G +E E +V + E + N ++ Sbjct: 2372 DVEDEEEEIEDEVESGVEVEEEDEEED---ESAEG---EEETEEEQKQVDEEESEVNEEE 2425 Query: 208 EVLADQNMEINEEEGETRKATYEI-SERPGDVSQAMDFEEYGSNSQNKVSIVLQGSEDKL 384 + ++ E+NEEE E + E+ E + + D +E +V + +E Sbjct: 2426 SEVNEEESEVNEEESEVNEEESEVEDEEVDEEDEDADLDEKVEEEDEEVDEEDEDAEGDQ 2485 Query: 385 ILQVDEEKISDENGTCVDSRATVEL-IASSPEHTESEVDLIGLVVLERIAEQTEQQSRNV 561 ++ +EE++ DE D A V+ + E E E + E E+ +++ ++ Sbjct: 2486 EVEQEEEEVEDEEMDEEDEDAEVDQEVEQEEEEVEDEEE-----EEEEEEEEEDEEEKDE 2540 Query: 562 NFSLTPEPEKSDGENLSLTPEAETADGVPEPVGADVEKVSNCIAAENLEVHEEKAGNIVG 741 + + E E+ + E E + + E D E+ + E EV EE++G+ Sbjct: 2541 DEEVDEEEEEEEKEEEEKEEEEKDEEEKDEDEEVDEEEAEEEVEEE--EVEEEESGSAEE 2598 Query: 742 YIKEAEEVTPTAMVDERSAGIDT 810 I+E EE + V+E +D+ Sbjct: 2599 AIEEEEEEGEESDVEEEEEEVDS 2621