BLASTX nr result
ID: Rheum21_contig00015871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00015871 (245 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444119.1| hypothetical protein CICLE_v10024447mg [Citr... 78 1e-12 gb|EPS59564.1| hypothetical protein M569_15243, partial [Genlise... 74 3e-11 gb|EXB39346.1| hypothetical protein L484_025041 [Morus notabilis] 72 8e-11 ref|XP_004247316.1| PREDICTED: uncharacterized protein LOC101258... 72 1e-10 ref|NP_001078333.1| protease inhibitor/seed storage/LTP family p... 72 1e-10 ref|XP_004495224.1| PREDICTED: uncharacterized protein LOC101511... 71 2e-10 ref|XP_002533067.1| conserved hypothetical protein [Ricinus comm... 71 2e-10 ref|XP_003637691.1| AAA ATPase containing von Willebrand factor ... 70 2e-10 ref|XP_006355869.1| PREDICTED: uncharacterized protein LOC102579... 69 5e-10 ref|XP_004493654.1| PREDICTED: uncharacterized protein LOC101500... 69 5e-10 ref|XP_002305616.2| hypothetical protein POPTR_0004s02190g, part... 69 8e-10 ref|XP_002302826.1| hypothetical protein POPTR_0002s22550g [Popu... 69 8e-10 emb|CBI32355.3| unnamed protein product [Vitis vinifera] 67 2e-09 emb|CAN64249.1| hypothetical protein VITISV_032977 [Vitis vinifera] 67 2e-09 ref|XP_006604424.1| PREDICTED: uncharacterized protein LOC102669... 67 3e-09 gb|ESW34399.1| hypothetical protein PHAVU_001G149300g [Phaseolus... 66 4e-09 ref|XP_006658907.1| PREDICTED: protein PFC0760c-like [Oryza brac... 66 5e-09 ref|XP_006375480.1| hypothetical protein POPTR_0014s13530g [Popu... 65 7e-09 gb|EOX94821.1| Tetratricopeptide repeat-like superfamily protein... 65 7e-09 gb|AGJ98242.1| PIG93, partial [Petunia x hybrida] 65 7e-09 >ref|XP_006444119.1| hypothetical protein CICLE_v10024447mg [Citrus clementina] gi|568852169|ref|XP_006479752.1| PREDICTED: uncharacterized protein LOC102623449 [Citrus sinensis] gi|557546381|gb|ESR57359.1| hypothetical protein CICLE_v10024447mg [Citrus clementina] Length = 160 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 7/62 (11%) Frame = -1 Query: 245 RHHGTAE-------CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECP 87 RH G E CCRWLK +DD CVC LL+RLP FL+ PVH Y V+VD+ C V Y C Sbjct: 96 RHGGVHEETPEGESCCRWLKQVDDECVCDLLVRLPVFLARPVHTYTVIVDESCNVTYACS 155 Query: 86 GR 81 GR Sbjct: 156 GR 157 >gb|EPS59564.1| hypothetical protein M569_15243, partial [Genlisea aurea] Length = 150 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = -1 Query: 227 ECCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGR 81 +CCRW+K +DD CVC LL+RLP FL+ PVH Y V VDD C V Y+C R Sbjct: 101 DCCRWVKEIDDVCVCELLVRLPPFLTRPVHNYTVAVDDLCSVTYQCSSR 149 >gb|EXB39346.1| hypothetical protein L484_025041 [Morus notabilis] Length = 156 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/58 (55%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = -1 Query: 245 RHHGTAE---CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGR 81 RH GT E CCRWL +D CVC +L+ LP FLS PVH Y ++V D C V Y C GR Sbjct: 95 RHQGTQEEDDCCRWLYEIDTDCVCEMLVHLPDFLSRPVHEYSLIVGDTCNVTYSCGGR 152 >ref|XP_004247316.1| PREDICTED: uncharacterized protein LOC101258484 [Solanum lycopersicum] Length = 155 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -1 Query: 224 CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGR 81 CCRW+K +D+ CVC LL+RLP FLS PVH Y +LVD C + +EC R Sbjct: 97 CCRWMKQVDNECVCDLLVRLPLFLSRPVHQYTILVDPGCNITFECGSR 144 >ref|NP_001078333.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis thaliana] gi|332646914|gb|AEE80435.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis thaliana] Length = 250 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = -1 Query: 227 ECCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGRFMN 72 ECC+WLK MD+ CVC LL+RLP L+ P+H Y V VD+ C V + C GR ++ Sbjct: 199 ECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGGRLIS 250 >ref|XP_004495224.1| PREDICTED: uncharacterized protein LOC101511533 [Cicer arietinum] Length = 173 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 3/56 (5%) Frame = -1 Query: 242 HHGTAE---CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPG 84 HH + E CCRW K MD RCVC +L+RLP FL+ P+H Y V++ + C + Y C G Sbjct: 116 HHSSTEEDNCCRWAKEMDSRCVCEILVRLPPFLTRPLHQYSVVIGESCVITYSCGG 171 >ref|XP_002533067.1| conserved hypothetical protein [Ricinus communis] gi|223527131|gb|EEF29306.1| conserved hypothetical protein [Ricinus communis] Length = 143 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -1 Query: 227 ECCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGR 81 +CCRWL +DD C+C LL+RLP FL+ P+H Y V++ D C V Y C GR Sbjct: 92 DCCRWLNDLDDECICELLVRLPPFLARPLHQYTVVIADACNVTYTCSGR 140 >ref|XP_003637691.1| AAA ATPase containing von Willebrand factor type A [Medicago truncatula] gi|355503626|gb|AES84829.1| AAA ATPase containing von Willebrand factor type A [Medicago truncatula] Length = 156 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/57 (50%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = -1 Query: 245 RHHGTAE---CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPG 84 RHH T + CCRW +A+D RCVC +L+RLP FL P+H Y V+ + C V Y C G Sbjct: 98 RHHDTTQEDNCCRWARALDSRCVCEILVRLPPFLIRPLHTYSVVFGESCTVTYSCGG 154 >ref|XP_006355869.1| PREDICTED: uncharacterized protein LOC102579338 [Solanum tuberosum] Length = 158 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -1 Query: 224 CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGR 81 CCRW+K +D CVC LL+RLP FLS P+H Y ++VD C + +EC R Sbjct: 100 CCRWMKQVDSECVCDLLVRLPLFLSRPLHQYTIMVDPGCNITFECGSR 147 >ref|XP_004493654.1| PREDICTED: uncharacterized protein LOC101500505 [Cicer arietinum] Length = 161 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/57 (50%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = -1 Query: 245 RHHGTAE---CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPG 84 R H T E CCRW + +D +CVC LL+RLP FL P+H Y + + DDCE+ Y C G Sbjct: 103 RRHQTPEEDNCCRWAREVDSQCVCELLVRLPPFLVRPLHVYTLAIGDDCEITYSCGG 159 >ref|XP_002305616.2| hypothetical protein POPTR_0004s02190g, partial [Populus trichocarpa] gi|550340132|gb|EEE86127.2| hypothetical protein POPTR_0004s02190g, partial [Populus trichocarpa] Length = 84 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/55 (52%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = -1 Query: 242 HHGTAE--CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPG 84 HHG+ E CC+WL A+D CVC LL RLP FLS P H Y + V + C + Y C G Sbjct: 30 HHGSIEENCCKWLGALDKECVCGLLHRLPVFLSKPAHQYTLYVSNSCNITYACDG 84 >ref|XP_002302826.1| hypothetical protein POPTR_0002s22550g [Populus trichocarpa] gi|222844552|gb|EEE82099.1| hypothetical protein POPTR_0002s22550g [Populus trichocarpa] Length = 139 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/53 (56%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = -1 Query: 242 HHGTAE--CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYEC 90 H GT E CCRWL +DD CVC LL+RLP FLS H Y + +DD C V Y C Sbjct: 84 HGGTQEDTCCRWLNDVDDECVCQLLVRLPPFLSRTRHEYTIKIDDSCSVSYTC 136 >emb|CBI32355.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -1 Query: 224 CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGR 81 CCRWLK +DD CVC LL LP FL+ P H Y V VD C V + C GR Sbjct: 63 CCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGR 110 >emb|CAN64249.1| hypothetical protein VITISV_032977 [Vitis vinifera] Length = 160 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -1 Query: 224 CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGR 81 CCRWLK +DD CVC LL LP FL+ P H Y V VD C V + C GR Sbjct: 110 CCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGR 157 >ref|XP_006604424.1| PREDICTED: uncharacterized protein LOC102669806 [Glycine max] Length = 155 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/55 (50%), Positives = 38/55 (69%), Gaps = 3/55 (5%) Frame = -1 Query: 245 RHHGTAE---CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYEC 90 R+H TA+ CCRW K +D++CVC LLLRLP FL P+H Y + V + C++ Y C Sbjct: 97 RNHQTADEDNCCRWAKEVDNQCVCELLLRLPPFLIRPLHQYTLNVGESCDITYSC 151 >gb|ESW34399.1| hypothetical protein PHAVU_001G149300g [Phaseolus vulgaris] Length = 151 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 3/55 (5%) Frame = -1 Query: 245 RHHGTAE---CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYEC 90 RHH T E CCRW K +D +CVC +L+ LP FL PVH Y + + D C+V Y C Sbjct: 93 RHHQTPEENNCCRWAKEVDSQCVCEILVHLPPFLIRPVHQYTLNIGDACDVTYSC 147 >ref|XP_006658907.1| PREDICTED: protein PFC0760c-like [Oryza brachyantha] Length = 188 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = -1 Query: 242 HHGTAECCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPG 84 H ++CCRWLK +D CVC LLRLP FL+ P H Y V V +C++ Y C G Sbjct: 135 HRAYSDCCRWLKEVDPACVCEALLRLPPFLTKPQHKYTVRVAKNCKLTYRCGG 187 >ref|XP_006375480.1| hypothetical protein POPTR_0014s13530g [Populus trichocarpa] gi|550324131|gb|ERP53277.1| hypothetical protein POPTR_0014s13530g [Populus trichocarpa] Length = 89 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/53 (54%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = -1 Query: 242 HHGTAE--CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYEC 90 H G E CCRWL +D CVC LL+RLP FLS P H Y V ++D C V Y C Sbjct: 37 HGGRLEQNCCRWLSDVDPECVCELLVRLPPFLSKPHHEYTVKINDSCSVSYSC 89 >gb|EOX94821.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 150 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = -1 Query: 224 CCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGRFM 75 CCRWLK +D CVC +L+ LP FLS P H Y V+VD+ C + C GR + Sbjct: 99 CCRWLKEVDHECVCEVLVHLPVFLSRPNHDYTVIVDETCSHTFTCGGRII 148 >gb|AGJ98242.1| PIG93, partial [Petunia x hybrida] Length = 79 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = -1 Query: 227 ECCRWLKAMDDRCVCTLLLRLPTFLSGPVHGYKVLVDDDCEVEYECPGR 81 ECCRW+K +D CVC LL +LP FLS P+H Y +VD C V + C R Sbjct: 19 ECCRWMKTVDSECVCGLLAQLPPFLSRPLHQYTAVVDASCSVTFMCSSR 67