BLASTX nr result
ID: Rheum21_contig00013773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00013773 (864 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516362.1| conserved hypothetical protein [Ricinus comm... 62 2e-07 >ref|XP_002516362.1| conserved hypothetical protein [Ricinus communis] gi|223544460|gb|EEF45979.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 62.4 bits (150), Expect = 2e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 432 KRSEEGEQMEGLSLPHKLLDPMAKADFDGFWVRVEE 325 +RSEEGE EGLSLPHKLLD MAKA F GFWVR+EE Sbjct: 43 QRSEEGEPKEGLSLPHKLLDSMAKAYFGGFWVRIEE 78