BLASTX nr result
ID: Rheum21_contig00011533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00011533 (487 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004299958.1| PREDICTED: uncharacterized protein C05D11.7-... 56 6e-06 >ref|XP_004299958.1| PREDICTED: uncharacterized protein C05D11.7-like [Fragaria vesca subsp. vesca] Length = 407 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 3/123 (2%) Frame = -2 Query: 360 PSPYSAMSRSLTRT--LTSKRNLPPFSKQAPQSEKSTSPSQPEEEAASQQKPSSFPLPS- 190 P P+S + +L L ++ L P ++ S + P+ + P P P+ Sbjct: 12 PHPFSLPNPNLNPNPNLVTRHTLLPLRTVKLKTSLPHSSTDPDTNGTASSAPPPLPPPAT 71 Query: 189 ADRKSLSVIAAEVFLGIATRLIKKLRGPARSTSSSVSVPILGNSARKDLDYDEKIGALVE 10 A +KS +V E+FLG+A+R+IK+ G S +++ SV + +S + DE+IG ++E Sbjct: 72 ATKKSFAVATGELFLGLASRIIKRRNGAPESETAAASVAMFESSGKFS---DERIGKVME 128 Query: 9 DSL 1 D + Sbjct: 129 DEI 131