BLASTX nr result
ID: Rheum21_contig00011088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00011088 (634 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006358965.1| PREDICTED: putative pentatricopeptide repeat... 68 3e-09 emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] 68 3e-09 ref|XP_003541836.1| PREDICTED: putative pentatricopeptide repeat... 67 4e-09 emb|CBI20261.3| unnamed protein product [Vitis vinifera] 67 4e-09 ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat... 67 4e-09 ref|XP_004252116.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 gb|ESW21488.1| hypothetical protein PHAVU_005G075100g [Phaseolus... 57 3e-06 gb|EXC08475.1| hypothetical protein L484_009618 [Morus notabilis] 56 8e-06 ref|XP_002532249.1| pentatricopeptide repeat-containing protein,... 56 8e-06 >ref|XP_006358965.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Solanum tuberosum] Length = 489 Score = 67.8 bits (164), Expect = 3e-09 Identities = 37/96 (38%), Positives = 56/96 (58%) Frame = -2 Query: 291 SFQAFSHSHETGHLKLPSCPEDAQIALRVQNLLKLSTNSSDEEELYRQFDGFGQSLLNED 112 SFQ SH H ++ + ++ AL+VQ LLK + S ++++ +L +ED Sbjct: 15 SFQPKMVSHF--HRQMHTISDEENCALKVQTLLKNKADKS-VSDIFQSLSNCNFTL-SED 70 Query: 111 TVVDVLSRHRSDWKPALRFFNWVSRGSHPGGYTPGS 4 +++VL RHRSDWKPA FF WV G +P GY+P + Sbjct: 71 FILNVLKRHRSDWKPAFTFFKWVLAGENPSGYSPNT 106 >emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] Length = 546 Score = 67.8 bits (164), Expect = 3e-09 Identities = 38/79 (48%), Positives = 45/79 (56%), Gaps = 3/79 (3%) Frame = -2 Query: 228 DAQIALRVQNLLKLSTNSSDEEELYRQFDGFGQSL---LNEDTVVDVLSRHRSDWKPALR 58 D + AL VQNLLK +SS E +G L +D V+DVL RHRSDW+PA Sbjct: 83 DGETALEVQNLLKTYRDSSVSE-----IEGALHQCRLSLTDDLVLDVLKRHRSDWRPAYV 137 Query: 57 FFNWVSRGSHPGGYTPGSG 1 FFNW SR GY+PG G Sbjct: 138 FFNWASRCGXESGYSPGCG 156 >ref|XP_003541836.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Glycine max] Length = 481 Score = 67.0 bits (162), Expect = 4e-09 Identities = 44/96 (45%), Positives = 56/96 (58%), Gaps = 1/96 (1%) Frame = -2 Query: 288 FQAFSHSHETGHLK-LPSCPEDAQIALRVQNLLKLSTNSSDEEELYRQFDGFGQSLLNED 112 FQ FS++ +T + + SCP A +QNLLK + E+ LYR D G L N D Sbjct: 16 FQTFSNNVKTSTPRFVHSCP-----ATFIQNLLKFRRDKPTEQ-LYRALDQCGFDL-NHD 68 Query: 111 TVVDVLSRHRSDWKPALRFFNWVSRGSHPGGYTPGS 4 V+DVL RHRSDW+PA FFNW S+ + GY P S Sbjct: 69 LVLDVLRRHRSDWRPAHVFFNWASKTT--TGYQPSS 102 >emb|CBI20261.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 67.0 bits (162), Expect = 4e-09 Identities = 38/79 (48%), Positives = 45/79 (56%), Gaps = 3/79 (3%) Frame = -2 Query: 228 DAQIALRVQNLLKLSTNSSDEEELYRQFDGFGQSL---LNEDTVVDVLSRHRSDWKPALR 58 D + AL VQNLLK +SS E +G L +D V+DVL RHRSDW+PA Sbjct: 83 DGETALEVQNLLKTYRDSSVSE-----IEGALHQCRLSLTDDLVLDVLKRHRSDWRPAYV 137 Query: 57 FFNWVSRGSHPGGYTPGSG 1 FFNW SR GY+PG G Sbjct: 138 FFNWASRCGIESGYSPGCG 156 >ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Vitis vinifera] Length = 546 Score = 67.0 bits (162), Expect = 4e-09 Identities = 38/79 (48%), Positives = 45/79 (56%), Gaps = 3/79 (3%) Frame = -2 Query: 228 DAQIALRVQNLLKLSTNSSDEEELYRQFDGFGQSL---LNEDTVVDVLSRHRSDWKPALR 58 D + AL VQNLLK +SS E +G L +D V+DVL RHRSDW+PA Sbjct: 83 DGETALEVQNLLKTYRDSSVSE-----IEGALHQCRLSLTDDLVLDVLKRHRSDWRPAYV 137 Query: 57 FFNWVSRGSHPGGYTPGSG 1 FFNW SR GY+PG G Sbjct: 138 FFNWASRCGIESGYSPGCG 156 >ref|XP_004252116.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Solanum lycopersicum] Length = 488 Score = 60.1 bits (144), Expect = 5e-07 Identities = 33/95 (34%), Positives = 48/95 (50%) Frame = -2 Query: 288 FQAFSHSHETGHLKLPSCPEDAQIALRVQNLLKLSTNSSDEEELYRQFDGFGQSLLNEDT 109 F +FS H + + ++ AL VQ LK + S + D L+ED Sbjct: 13 FYSFSKMTSGFHRLMHTISDEENCALEVQTFLKNKADKSVSDIFQSLSDC--NFTLSEDF 70 Query: 108 VVDVLSRHRSDWKPALRFFNWVSRGSHPGGYTPGS 4 +++VL RHRSDWKPA FF W+ G +P Y+P + Sbjct: 71 ILNVLKRHRSDWKPAFIFFKWILAGENPCRYSPNT 105 >gb|ESW21488.1| hypothetical protein PHAVU_005G075100g [Phaseolus vulgaris] Length = 478 Score = 57.4 bits (137), Expect = 3e-06 Identities = 36/79 (45%), Positives = 44/79 (55%) Frame = -2 Query: 240 SCPEDAQIALRVQNLLKLSTNSSDEEELYRQFDGFGQSLLNEDTVVDVLSRHRSDWKPAL 61 SCP A +QNLLK + ++ L+R D G L N + V+DVL RHRSDW+PA Sbjct: 32 SCP-----ASLIQNLLKFRRDKPTDQ-LHRALDQCGVDL-NHNLVLDVLRRHRSDWRPAH 84 Query: 60 RFFNWVSRGSHPGGYTPGS 4 FFNW S GY P S Sbjct: 85 VFFNW----SKTAGYEPSS 99 >gb|EXC08475.1| hypothetical protein L484_009618 [Morus notabilis] Length = 530 Score = 56.2 bits (134), Expect = 8e-06 Identities = 35/97 (36%), Positives = 55/97 (56%) Frame = -2 Query: 294 PSFQAFSHSHETGHLKLPSCPEDAQIALRVQNLLKLSTNSSDEEELYRQFDGFGQSLLNE 115 P ++F++S ++ + P D +IA+ +QN++K S EE + R D G L E Sbjct: 68 PFVRSFANSADSDEFE--GDPND-RIAVWIQNIIKFRREKSTEE-IERALDMCGFEL-TE 122 Query: 114 DTVVDVLSRHRSDWKPALRFFNWVSRGSHPGGYTPGS 4 + +++VL RH+SDWK A FFNW +G G+ GS Sbjct: 123 ELLLNVLHRHQSDWKLAYVFFNWACKGGGSNGFLLGS 159 >ref|XP_002532249.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528067|gb|EEF30143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 56.2 bits (134), Expect = 8e-06 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 2/76 (2%) Frame = -2 Query: 222 QIALRVQNLLKLSTNSSDE--EELYRQFDGFGQSLLNEDTVVDVLSRHRSDWKPALRFFN 49 ++AL+VQN+LK +S E Q + + ED ++ VL RHRSDWKPAL FFN Sbjct: 47 ELALKVQNVLKNYRDSPTRKIELALTQCN----PTVTEDLILKVLKRHRSDWKPALIFFN 102 Query: 48 WVSRGSHPGGYTPGSG 1 WVS+G G GSG Sbjct: 103 WVSKG---GKVLMGSG 115