BLASTX nr result
ID: Rheum21_contig00010713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00010713 (342 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_173076.1| wall-associated receptor kinase-like 8 [Arabido... 59 5e-07 gb|EXB93593.1| Wall-associated receptor kinase-like 10 [Morus no... 57 3e-06 ref|XP_006305972.1| hypothetical protein CARUB_v10011235mg [Caps... 57 3e-06 ref|XP_002333795.1| predicted protein [Populus trichocarpa] 56 4e-06 >ref|NP_173076.1| wall-associated receptor kinase-like 8 [Arabidopsis thaliana] gi|334182612|ref|NP_001185009.1| wall-associated receptor kinase-like 8 [Arabidopsis thaliana] gi|75265500|sp|Q9SA25.1|WAKLG_ARATH RecName: Full=Wall-associated receptor kinase-like 8; Flags: Precursor gi|4966347|gb|AAD34678.1|AC006341_6 Similar to gb|AJ012423 wall-associated kinase 2 from Arabidopsis thaliana [Arabidopsis thaliana] gi|110739498|dbj|BAF01658.1| putative wall-associated kinase [Arabidopsis thaliana] gi|332191306|gb|AEE29427.1| wall-associated receptor kinase-like 8 [Arabidopsis thaliana] gi|332191307|gb|AEE29428.1| wall-associated receptor kinase-like 8 [Arabidopsis thaliana] Length = 720 Score = 59.3 bits (142), Expect = 5e-07 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -2 Query: 95 RGCNDTCGNVSIPFPFGMGKGCFSDKWFEI 6 R C+D CGNVS+P+PFG+GKGC+ +KWFEI Sbjct: 31 RNCSDHCGNVSVPYPFGIGKGCYKNKWFEI 60 >gb|EXB93593.1| Wall-associated receptor kinase-like 10 [Morus notabilis] Length = 766 Score = 56.6 bits (135), Expect = 3e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -2 Query: 98 RRGCNDTCGNVSIPFPFGMGKGCFSDKWFEI 6 ++ C +CGN++IPFPFG+GKGCF D+WFE+ Sbjct: 36 KKSCLSSCGNITIPFPFGIGKGCFIDEWFEV 66 >ref|XP_006305972.1| hypothetical protein CARUB_v10011235mg [Capsella rubella] gi|482574683|gb|EOA38870.1| hypothetical protein CARUB_v10011235mg [Capsella rubella] Length = 725 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -2 Query: 89 CNDTCGNVSIPFPFGMGKGCFSDKWFEI 6 C D CGN+SIP+PFG+GKGC+ KWFEI Sbjct: 34 CRDHCGNISIPYPFGIGKGCYKSKWFEI 61 >ref|XP_002333795.1| predicted protein [Populus trichocarpa] Length = 602 Score = 56.2 bits (134), Expect = 4e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = -2 Query: 98 RRGCNDTCGNVSIPFPFGMGKGCFSDKWFEIE 3 R C DTCGN+SIPFPFG+G GC+ ++WF ++ Sbjct: 22 RPNCTDTCGNISIPFPFGIGTGCYRNEWFSVD 53