BLASTX nr result
ID: Rheum21_contig00010709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00010709 (237 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524548.1| suppressor of ty, putative [Ricinus communis... 59 7e-07 ref|XP_002322597.2| hypothetical protein POPTR_0016s02900g [Popu... 57 2e-06 ref|XP_002322598.1| predicted protein [Populus trichocarpa] 57 2e-06 ref|XP_002278416.2| PREDICTED: transcription elongation factor S... 56 4e-06 emb|CBI32841.3| unnamed protein product [Vitis vinifera] 56 4e-06 >ref|XP_002524548.1| suppressor of ty, putative [Ricinus communis] gi|223536178|gb|EEF37832.1| suppressor of ty, putative [Ricinus communis] Length = 1650 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +3 Query: 84 DRQDSGY-NSRRGSQSKDGESSGGWGSFPGSKVENSPGREAFP 209 D+Q+SGY NS+ S +KD S GWGSFPG+KV+NSPGREAFP Sbjct: 1540 DKQESGYDNSKWDSVAKD--SDAGWGSFPGAKVQNSPGREAFP 1580 >ref|XP_002322597.2| hypothetical protein POPTR_0016s02900g [Populus trichocarpa] gi|550320692|gb|EEF04358.2| hypothetical protein POPTR_0016s02900g [Populus trichocarpa] Length = 1692 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +3 Query: 84 DRQDSGYNSRR-GSQSKDGESSGGWGSFPGSKVENSPGREAFP 209 +RQDSGY+ R S +KD + GWGSFPG+KV+NSPGREAFP Sbjct: 1519 ERQDSGYDKPRWDSGTKDNDE--GWGSFPGAKVQNSPGREAFP 1559 >ref|XP_002322598.1| predicted protein [Populus trichocarpa] Length = 287 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +3 Query: 84 DRQDSGYNSRR-GSQSKDGESSGGWGSFPGSKVENSPGREAFP 209 +RQDSGY+ R S +KD + GWGSFPG+KV+NSPGREAFP Sbjct: 114 ERQDSGYDKPRWDSGTKDNDE--GWGSFPGAKVQNSPGREAFP 154 >ref|XP_002278416.2| PREDICTED: transcription elongation factor SPT6-like [Vitis vinifera] Length = 1660 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +3 Query: 84 DRQDSGYNSRR-GSQSKDGESSGGWGSFPGSKVENSPGREAFP 209 +RQDSGY + + S SKDGE GW SFPG+KV+NSPG+E+FP Sbjct: 1538 ERQDSGYGTPKWDSGSKDGED--GWNSFPGAKVQNSPGKESFP 1578 >emb|CBI32841.3| unnamed protein product [Vitis vinifera] Length = 1646 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +3 Query: 84 DRQDSGYNSRR-GSQSKDGESSGGWGSFPGSKVENSPGREAFP 209 +RQDSGY + + S SKDGE GW SFPG+KV+NSPG+E+FP Sbjct: 1524 ERQDSGYGTPKWDSGSKDGED--GWNSFPGAKVQNSPGKESFP 1564