BLASTX nr result
ID: Rheum21_contig00009244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00009244 (254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCO25538.1| glutamine synthetase [Pinus pinaster] 62 6e-08 emb|CAA52448.1| glutamate--ammonia ligase [Pinus sylvestris] 62 8e-08 emb|CAA06383.1| glutamine synthetase [Pinus sylvestris] 62 8e-08 sp|P52783.1|GLNA_PINSY RecName: Full=Glutamine synthetase cytoso... 62 8e-08 gb|AEH16645.1| glutamine synthetase [Knorringia sibirica] 61 1e-07 emb|CAA12405.1| glutamine synthetase [Pinus sylvestris] 61 2e-07 ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutr... 60 2e-07 gb|AFN42876.1| glutamine synthetase [Camellia sinensis] 60 2e-07 ref|XP_003570690.1| PREDICTED: glutamine synthetase cytosolic is... 60 2e-07 dbj|BAA04995.1| glutamine synthetase [Raphanus sativus] 60 3e-07 gb|ABK21449.1| unknown [Picea sitchensis] gi|116784513|gb|ABK233... 60 3e-07 gb|EXC36091.1| Glutamine synthetase nodule isozyme [Morus notabi... 60 4e-07 emb|CAA54151.1| glutamine [Brassica napus] gi|60686427|gb|AAX353... 60 4e-07 ref|XP_006828441.1| hypothetical protein AMTR_s00060p00116070 [A... 60 4e-07 ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozy... 60 4e-07 gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus pe... 60 4e-07 emb|CAA73063.1| cytosolic glutamine synthetase [Brassica napus] ... 60 4e-07 sp|P52782.1|GLNA_LUPLU RecName: Full=Glutamine synthetase nodule... 60 4e-07 gb|ACD13217.1| glutamine synthetase [Brassica rapa subsp. chinen... 60 4e-07 gb|ACN40288.1| unknown [Picea sitchensis] 60 4e-07 >emb|CCO25538.1| glutamine synthetase [Pinus pinaster] Length = 355 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/33 (78%), Positives = 33/33 (100%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NLDLSDVTEK+IAEYIW+GGSG+D+ Sbjct: 1 MSLLTDLINLDLSDVTEKIIAEYIWIGGSGMDI 33 >emb|CAA52448.1| glutamate--ammonia ligase [Pinus sylvestris] Length = 357 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 98 SIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 S++TDLLNLDLSDVTEKVIAEYIW+GGSG+D+ Sbjct: 3 SVLTDLLNLDLSDVTEKVIAEYIWIGGSGMDM 34 >emb|CAA06383.1| glutamine synthetase [Pinus sylvestris] Length = 355 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/33 (75%), Positives = 33/33 (100%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NLDLSD+TEK+IAEYIW+GGSG+D+ Sbjct: 1 MSLLTDLINLDLSDITEKIIAEYIWIGGSGMDI 33 >sp|P52783.1|GLNA_PINSY RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: Full=GS1; AltName: Full=Glutamate--ammonia ligase gi|404327|emb|CAA49476.1| glutamate--ammonia ligase [Pinus sylvestris] Length = 357 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 98 SIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 S++TDLLNLDLSDVTEKVIAEYIW+GGSG+D+ Sbjct: 3 SVLTDLLNLDLSDVTEKVIAEYIWIGGSGMDM 34 >gb|AEH16645.1| glutamine synthetase [Knorringia sibirica] Length = 356 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NL+LSDVTEKVIAEYIW+GGSG+DL Sbjct: 1 MSLLTDLVNLNLSDVTEKVIAEYIWIGGSGMDL 33 >emb|CAA12405.1| glutamine synthetase [Pinus sylvestris] Length = 200 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -1 Query: 98 SIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 S++TDLLNLDLSD+TEKVIAEYIW+GGSG+D+ Sbjct: 3 SVLTDLLNLDLSDLTEKVIAEYIWIGGSGMDM 34 >ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum] gi|557087798|gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum] Length = 356 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NLDLSD TEK+IAEYIWVGGSG+D+ Sbjct: 1 MSLLTDLINLDLSDSTEKIIAEYIWVGGSGMDM 33 >gb|AFN42876.1| glutamine synthetase [Camellia sinensis] Length = 356 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS+++DL+NLDLSD TEKVIAEYIW+GGSG+DL Sbjct: 1 MSLLSDLINLDLSDTTEKVIAEYIWIGGSGMDL 33 >ref|XP_003570690.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Brachypodium distachyon] Length = 356 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 M+++TDLLNLDLSD TEK+IAEYIW+GGSG+DL Sbjct: 1 MALLTDLLNLDLSDSTEKIIAEYIWIGGSGMDL 33 >dbj|BAA04995.1| glutamine synthetase [Raphanus sativus] Length = 356 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NLDLSD TEK+IAEYIWVGGSG+D+ Sbjct: 1 MSLLTDLINLDLSDNTEKIIAEYIWVGGSGMDM 33 >gb|ABK21449.1| unknown [Picea sitchensis] gi|116784513|gb|ABK23372.1| unknown [Picea sitchensis] Length = 357 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 98 SIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 S++ DLLNLDLSDVTEKVIAEYIW+GGSG+D+ Sbjct: 3 SVLADLLNLDLSDVTEKVIAEYIWIGGSGMDM 34 >gb|EXC36091.1| Glutamine synthetase nodule isozyme [Morus notabilis] Length = 327 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDLLNL+LSD T+K+IAEYIW+GGSG+DL Sbjct: 1 MSLLTDLLNLNLSDTTDKIIAEYIWIGGSGLDL 33 >emb|CAA54151.1| glutamine [Brassica napus] gi|60686427|gb|AAX35342.1| glutamine synthetase [Brassica rapa subsp. pekinensis] Length = 356 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NLDLSD TEK+IAEYIWVGGSG+D+ Sbjct: 1 MSLLTDLVNLDLSDNTEKIIAEYIWVGGSGMDM 33 >ref|XP_006828441.1| hypothetical protein AMTR_s00060p00116070 [Amborella trichopoda] gi|548833189|gb|ERM95857.1| hypothetical protein AMTR_s00060p00116070 [Amborella trichopoda] Length = 356 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MSI+TDLLNLDL+D T K+IAEYIWVGGSG+DL Sbjct: 1 MSILTDLLNLDLTDCTTKIIAEYIWVGGSGMDL 33 >ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme-like [Fragaria vesca subsp. vesca] Length = 356 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NLDLSD T+K+IAEYIW+GGSG+DL Sbjct: 1 MSLLTDLINLDLSDSTDKIIAEYIWIGGSGMDL 33 >gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica] Length = 356 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS+++DL+NLDLSD TEKVIAEYIW+GGSG+DL Sbjct: 1 MSLLSDLINLDLSDSTEKVIAEYIWIGGSGMDL 33 >emb|CAA73063.1| cytosolic glutamine synthetase [Brassica napus] gi|194307194|gb|ACF42115.1| cytosolic glutamine synthetase [Brassica oleracea var. botrytis] Length = 356 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NLDLSD TEK+IAEYIWVGGSG+D+ Sbjct: 1 MSLLTDLVNLDLSDNTEKIIAEYIWVGGSGMDM 33 >sp|P52782.1|GLNA_LUPLU RecName: Full=Glutamine synthetase nodule isozyme; Short=GS; AltName: Full=Glutamate--ammonia ligase gi|454312|emb|CAA50522.1| glutamate-ammonia ligase [Lupinus luteus] gi|739988|prf||2004276A Gln synthetase Length = 353 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS+++DL+NL+LSD TEK+IAEYIWVGGSG+DL Sbjct: 1 MSVLSDLINLNLSDTTEKIIAEYIWVGGSGVDL 33 >gb|ACD13217.1| glutamine synthetase [Brassica rapa subsp. chinensis] Length = 356 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NLDLSD TEK+IAEYIWVGGSG+D+ Sbjct: 1 MSLLTDLVNLDLSDNTEKIIAEYIWVGGSGMDM 33 >gb|ACN40288.1| unknown [Picea sitchensis] Length = 355 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 101 MSIVTDLLNLDLSDVTEKVIAEYIWVGGSGIDL 3 MS++TDL+NL+LSDVTEK+IAEYIW+GGSG D+ Sbjct: 1 MSLLTDLINLNLSDVTEKIIAEYIWIGGSGTDI 33