BLASTX nr result
ID: Rheum21_contig00009084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00009084 (217 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513064.1| PREDICTED: mitogen-activated protein kinase ... 91 2e-16 ref|XP_003535888.1| PREDICTED: mitogen-activated protein kinase ... 91 2e-16 ref|XP_002283491.1| PREDICTED: mitogen-activated protein kinase ... 89 5e-16 gb|ESW24953.1| hypothetical protein PHAVU_004G174500g [Phaseolus... 89 8e-16 gb|ESW24952.1| hypothetical protein PHAVU_004G174500g [Phaseolus... 89 8e-16 ref|XP_006575258.1| PREDICTED: mitogen-activated protein kinase ... 86 4e-15 gb|EOY30615.1| Mitogen-activated protein kinase kinase 6 isoform... 86 5e-15 gb|EOY30613.1| MAP kinase kinase 6 isoform 1 [Theobroma cacao] g... 86 5e-15 ref|XP_006475342.1| PREDICTED: mitogen-activated protein kinase ... 85 9e-15 ref|XP_006451333.1| hypothetical protein CICLE_v10008771mg [Citr... 85 9e-15 gb|ADR31547.1| mitogen-activated protein kinase kinase 6 [Gossyp... 85 1e-14 gb|EXC28690.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabi... 82 6e-14 dbj|BAB32405.1| NQK1 MAPKK [Nicotiana tabacum] 81 2e-13 emb|CAC24705.1| MAP kinase [Nicotiana tabacum] 81 2e-13 gb|AHF27584.1| mitogen-activated protein kinase kinase 6 [Solanu... 81 2e-13 ref|XP_006341608.1| PREDICTED: mitogen-activated protein kinase ... 81 2e-13 gb|ADT91698.1| mitogen activated protein kinase kinase [Nicotian... 81 2e-13 dbj|BAG31943.1| MAP kinase [Nicotiana benthamiana] 81 2e-13 ref|NP_001234591.1| MAPKK [Solanum lycopersicum] gi|51471930|gb|... 81 2e-13 gb|ABT17464.1| mitogen activated protein kinase kinase 1 [Origan... 80 2e-13 >ref|XP_004513064.1| PREDICTED: mitogen-activated protein kinase kinase 6-like [Cicer arietinum] Length = 354 Score = 90.9 bits (224), Expect = 2e-16 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK KTPLK LKLSVPAQQTP+T+FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 1 MKTKTPLKQLKLSVPAQQTPITSFLTASGTFHDGDLLLNQKGLRLISEEK 50 >ref|XP_003535888.1| PREDICTED: mitogen-activated protein kinase kinase 6-like [Glycine max] Length = 356 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 62 KMKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 KMK KTPLK LKL+VPAQ+TP+T+FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 2 KMKTKTPLKQLKLAVPAQETPITSFLTASGTFHDGDLLLNQKGLRLISEEK 52 >ref|XP_002283491.1| PREDICTED: mitogen-activated protein kinase kinase 6 [Vitis vinifera] gi|147852632|emb|CAN79548.1| hypothetical protein VITISV_041078 [Vitis vinifera] gi|297738739|emb|CBI27984.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 89.4 bits (220), Expect = 5e-16 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK K PLK LKLSVPAQ+TP+T+FLTASGTFQDGDLLLNQKGLRLISEEK Sbjct: 1 MKSKKPLKQLKLSVPAQETPITSFLTASGTFQDGDLLLNQKGLRLISEEK 50 >gb|ESW24953.1| hypothetical protein PHAVU_004G174500g [Phaseolus vulgaris] Length = 354 Score = 88.6 bits (218), Expect = 8e-16 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK KTPLK LKL+VPAQ+TP+T+FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 1 MKTKTPLKQLKLAVPAQETPITSFLTASGTFHDGDLLLNQKGLRLISEEK 50 >gb|ESW24952.1| hypothetical protein PHAVU_004G174500g [Phaseolus vulgaris] Length = 324 Score = 88.6 bits (218), Expect = 8e-16 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK KTPLK LKL+VPAQ+TP+T+FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 1 MKTKTPLKQLKLAVPAQETPITSFLTASGTFHDGDLLLNQKGLRLISEEK 50 >ref|XP_006575258.1| PREDICTED: mitogen-activated protein kinase kinase 6-like [Glycine max] Length = 354 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK K PLK LKL+VPAQ+TP+T+FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 1 MKTKMPLKQLKLAVPAQETPITSFLTASGTFHDGDLLLNQKGLRLISEEK 50 >gb|EOY30615.1| Mitogen-activated protein kinase kinase 6 isoform 3 [Theobroma cacao] Length = 334 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK K PLK LKLSVPAQ+TP+++FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 1 MKSKKPLKQLKLSVPAQETPISSFLTASGTFHDGDLLLNQKGLRLISEEK 50 >gb|EOY30613.1| MAP kinase kinase 6 isoform 1 [Theobroma cacao] gi|508783358|gb|EOY30614.1| MAP kinase kinase 6 isoform 1 [Theobroma cacao] Length = 354 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK K PLK LKLSVPAQ+TP+++FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 1 MKSKKPLKQLKLSVPAQETPISSFLTASGTFHDGDLLLNQKGLRLISEEK 50 >ref|XP_006475342.1| PREDICTED: mitogen-activated protein kinase kinase 6-like [Citrus sinensis] Length = 357 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 M+ KTPLK LKLSVP Q+TP+T+FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MRTKTPLKQLKLSVPVQETPITSFLTASGTFHDGDLLLNQKGLRLISEE 49 >ref|XP_006451333.1| hypothetical protein CICLE_v10008771mg [Citrus clementina] gi|557554559|gb|ESR64573.1| hypothetical protein CICLE_v10008771mg [Citrus clementina] Length = 354 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 M+ KTPLK LKLSVP Q+TP+T+FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MRTKTPLKQLKLSVPVQETPITSFLTASGTFHDGDLLLNQKGLRLISEE 49 >gb|ADR31547.1| mitogen-activated protein kinase kinase 6 [Gossypium hirsutum] gi|313103465|gb|ADR31548.1| mitogen-activated protein kinase kinase 6 [Gossypium hirsutum] Length = 354 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK K PLK LKL+VPAQ+TP+++FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 1 MKSKKPLKQLKLAVPAQETPISSFLTASGTFHDGDLLLNQKGLRLISEEK 50 >gb|EXC28690.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis] Length = 1369 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEEK 214 MK KTPLK LKLSVP ++T +++FLTASGTF DGDLLLNQKGLRLISEEK Sbjct: 1016 MKTKTPLKQLKLSVPTEETTISSFLTASGTFHDGDLLLNQKGLRLISEEK 1065 >dbj|BAB32405.1| NQK1 MAPKK [Nicotiana tabacum] Length = 354 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 MK PLK LKLSVPAQ TP+++FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MKTTKPLKELKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEE 49 >emb|CAC24705.1| MAP kinase [Nicotiana tabacum] Length = 354 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 MK PLK LKLSVPAQ TP+++FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MKTTKPLKELKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEE 49 >gb|AHF27584.1| mitogen-activated protein kinase kinase 6 [Solanum tuberosum] Length = 354 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 MK PLK LKLSVPAQ TP+++FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MKTTKPLKQLKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEE 49 >ref|XP_006341608.1| PREDICTED: mitogen-activated protein kinase kinase 6-like [Solanum tuberosum] Length = 354 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 MK PLK LKLSVPAQ TP+++FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MKTAKPLKQLKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEE 49 >gb|ADT91698.1| mitogen activated protein kinase kinase [Nicotiana attenuata] Length = 354 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 MK PLK LKLSVPAQ TP+++FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MKTTKPLKELKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEE 49 >dbj|BAG31943.1| MAP kinase [Nicotiana benthamiana] Length = 354 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 MK PLK LKLSVPAQ TP+++FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MKTTKPLKELKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEE 49 >ref|NP_001234591.1| MAPKK [Solanum lycopersicum] gi|51471930|gb|AAU04435.1| MAPKK [Solanum lycopersicum] Length = 354 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 MK PLK LKLSVPAQ TP+++FLTASGTF DGDLLLNQKGLRLISEE Sbjct: 1 MKTAKPLKQLKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEE 49 >gb|ABT17464.1| mitogen activated protein kinase kinase 1 [Origanum onites] Length = 353 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 65 MKCKTPLKPLKLSVPAQQTPLTNFLTASGTFQDGDLLLNQKGLRLISEE 211 MK K PLK LKLSVPAQ +P+++FLTASGTF DGDLLLNQKGLRLIS+E Sbjct: 1 MKLKKPLKELKLSVPAQNSPISSFLTASGTFHDGDLLLNQKGLRLISDE 49