BLASTX nr result
ID: Rheum21_contig00007652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00007652 (422 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628521.1| Metallothionein-like protein [Medicago trunc... 65 7e-09 gb|AFK33631.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_004511248.1| PREDICTED: metallothionein-like protein type... 62 1e-07 ref|XP_004511246.1| PREDICTED: metallothionein-like protein type... 58 1e-06 >ref|XP_003628521.1| Metallothionein-like protein [Medicago truncatula] gi|355522543|gb|AET02997.1| Metallothionein-like protein [Medicago truncatula] gi|388521467|gb|AFK48795.1| unknown [Medicago truncatula] Length = 63 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 352 CGNCNCADKSQCGKGNQYGFEIIETQQTSFIESVMMDA 239 CGNC+CADKSQCGKGN YG I+ETQ+ SF+E+V+MDA Sbjct: 5 CGNCDCADKSQCGKGNNYGMTIVETQK-SFVETVVMDA 41 >gb|AFK33631.1| unknown [Lotus japonicus] Length = 65 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 352 CGNCNCADKSQCGKGNQYGFEIIETQQTSFIESVMMD 242 CGNC+CADKSQCGKGN YG I+ET QTS++E+V MD Sbjct: 5 CGNCDCADKSQCGKGNSYGLNIVET-QTSYVETVAMD 40 >ref|XP_004511248.1| PREDICTED: metallothionein-like protein type 3-like [Cicer arietinum] Length = 65 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -2 Query: 352 CGNCNCADKSQCGKGNQYGFEIIETQQTSFIESVMMD 242 CGNCNCADK+QCGKGN YG I+ET++ S++E+V+MD Sbjct: 5 CGNCNCADKNQCGKGNNYGVTIVETEK-SYLETVIMD 40 >ref|XP_004511246.1| PREDICTED: metallothionein-like protein type 3-like [Cicer arietinum] Length = 65 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -2 Query: 352 CGNCNCADKSQCGKGNQYGFEIIETQQTSFIESVMMD 242 C NCNCADK+QCGKGN YG I+ET++ S++E+V+MD Sbjct: 5 CVNCNCADKNQCGKGNNYGVTIVETEK-SYLETVVMD 40