BLASTX nr result
ID: Rheum21_contig00006475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00006475 (318 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005163258.1| PREDICTED: histone H3-like centromeric prote... 59 7e-07 >ref|XP_005163258.1| PREDICTED: histone H3-like centromeric protein CSE4-like [Danio rerio] Length = 283 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 316 AIHAKRVTIMPKDIQLARRIRGERA*ALFCCLVAD 212 AIHAKRVTIMPKDIQLARRIRGERA FCC + + Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGERASTRFCCNILE 146