BLASTX nr result
ID: Rheum21_contig00006261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00006261 (227 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 74 3e-11 gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] 73 5e-11 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 72 6e-11 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 72 6e-11 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 72 8e-11 ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 71 1e-10 gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlise... 71 1e-10 ref|XP_004492183.1| PREDICTED: mitochondrial import receptor sub... 71 1e-10 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 71 2e-10 ref|NP_564545.1| translocase of the outer mitochondrial membrane... 70 2e-10 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 70 3e-10 gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus... 69 5e-10 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 69 7e-10 gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6... 69 9e-10 ref|XP_006393259.1| hypothetical protein EUTSA_v10011932mg [Eutr... 67 2e-09 ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arab... 65 7e-09 ref|XP_006592291.1| PREDICTED: mitochondrial import receptor sub... 65 1e-08 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPG+F KKPDKAEALKQLRSH AMFGAWV V+R+ PY+ Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYV 39 >gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQLR+H AMFGAWVAVIR+ PYI Sbjct: 1 MFPGMFMRKPDKAAALKQLRTHVAMFGAWVAVIRVTPYI 39 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 54 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL+SHAAMFGAWV VIR+ PY+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGAWVVVIRVTPYV 39 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKAEALKQL+SH AMFGAWV V+R+ PY+ Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYV 39 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQLRSH AMFG WVAVIR+ PY+ Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYV 39 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF KKPDKA ALKQLRSH AMFG WV VIR+ PY+ Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYL 39 >gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlisea aurea] Length = 54 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL+SHA MFGAW+AV+R APY+ Sbjct: 2 MFPGMFMRKPDKAAALKQLKSHAIMFGAWIAVVRAAPYV 40 >ref|XP_004492183.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cicer arietinum] Length = 54 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL+SH AMFG WV VIR+APYI Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGTWVVVIRVAPYI 39 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL+SHAAMFG WV VIR+ PY+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYV 39 >ref|NP_564545.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] gi|46577137|sp|Q9XIA7.1|TOM6_ARATH RecName: Full=Mitochondrial import receptor subunit TOM6 homolog; AltName: Full=Translocase of outer membrane 6 kDa subunit homolog gi|5430759|gb|AAD43159.1|AC007504_14 Unknown Protein [Arabidopsis thaliana] gi|11692924|gb|AAG40065.1|AF324714_1 At1g49410 [Arabidopsis thaliana] gi|11762280|gb|AAG40411.1|AF325059_1 At1g49410 [Arabidopsis thaliana] gi|11935199|gb|AAG42015.1|AF327425_1 unknown protein [Arabidopsis thaliana] gi|12642920|gb|AAK00402.1|AF339720_1 unknown protein [Arabidopsis thaliana] gi|14335020|gb|AAK59774.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|27363338|gb|AAO11588.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|332194306|gb|AEE32427.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] Length = 54 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKAEALKQLR+H A+FG+WV +IR APY+ Sbjct: 1 MFPGMFMRKPDKAEALKQLRTHVALFGSWVVIIRAAPYV 39 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL++HAA+FGAWVA+IR+ PY+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYV 39 >gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL+SH MFGAWV VIR+ PY+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVTMFGAWVVVIRVTPYV 39 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] gi|565399930|ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL++H +FG WVAVIR+APYI Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVAPYI 39 >gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL+ H AMFG WVAV+R+ PYI Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYI 39 >ref|XP_006393259.1| hypothetical protein EUTSA_v10011932mg [Eutrema salsugineum] gi|557089837|gb|ESQ30545.1| hypothetical protein EUTSA_v10011932mg [Eutrema salsugineum] Length = 54 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQLR+HAA+FG WV VIR PY+ Sbjct: 1 MFPGMFMQKPDKAVALKQLRTHAALFGGWVVVIRAVPYV 39 >ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] gi|297340022|gb|EFH70439.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQLR+H A+FG WV ++R PY+ Sbjct: 1 MFPGMFMRKPDKAVALKQLRTHVALFGGWVVIVRAVPYV 39 >ref|XP_006592291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 83 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 169 MFPGMFQKKPDKAEALKQLRSHAAMFGAWVAVIRIAPYI 53 MFPGMF +KPDKA ALKQL+SH MF AWV VI++ PY+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVVMFQAWVVVIQVTPYV 39