BLASTX nr result
ID: Rheum21_contig00004085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00004085 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus... 91 2e-16 ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 91 2e-16 gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus... 90 3e-16 gb|AFK42911.1| unknown [Medicago truncatula] 90 4e-16 gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] 89 5e-16 gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] 89 6e-16 ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like ... 89 6e-16 ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatu... 89 6e-16 ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 89 6e-16 ref|XP_006597712.1| PREDICTED: 60S ribosomal protein L29-1 [Glyc... 89 8e-16 ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like ... 87 2e-15 gb|EPS58528.1| hypothetical protein M569_16287, partial [Genlise... 87 2e-15 ref|XP_002314927.2| hypothetical protein POPTR_0010s15190g, part... 87 3e-15 gb|ABK92573.1| unknown [Populus trichocarpa] gi|118482323|gb|ABK... 87 3e-15 ref|XP_006298920.1| hypothetical protein CARUB_v10015053mg [Caps... 86 5e-15 gb|AFK48186.1| unknown [Lotus japonicus] 86 5e-15 ref|XP_006488862.1| PREDICTED: 60S ribosomal protein L29-1-like ... 86 7e-15 ref|XP_006419418.1| hypothetical protein CICLE_v10006499mg, part... 86 7e-15 ref|XP_006829382.1| hypothetical protein AMTR_s03807p00002720 [A... 86 7e-15 ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like ... 86 7e-15 >ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus communis] gi|223541515|gb|EEF43064.1| 60S ribosomal protein L29, putative [Ricinus communis] Length = 61 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP +QRH STKGMDPKFLRNQRYARKHNKKS E A+ EE Sbjct: 12 QSYKAHKNGIKKPKRQRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147802163|emb|CAN65958.1| hypothetical protein VITISV_007494 [Vitis vinifera] gi|296083268|emb|CBI22904.3| unnamed protein product [Vitis vinifera] Length = 61 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP K RH STKGMDPKFLRNQRYARKHNKKS E+A+ EE Sbjct: 12 QSYKAHKNGIKKPRKHRHASTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gi|561027712|gb|ESW26352.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] Length = 61 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKKS E AS EE Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETASEEE 61 >gb|AFK42911.1| unknown [Medicago truncatula] Length = 61 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKK+ E AS EE Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEVASAEE 61 >gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] Length = 61 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKKS E+A+ EE Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] Length = 61 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP K RH STKGMDPKFLRNQRYARKHN KS EA S EE Sbjct: 12 QSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGEAGSGEE 61 >ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356529227|ref|XP_003533197.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356564681|ref|XP_003550578.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] Length = 61 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKKS E A+ EE Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatula] gi|355510808|gb|AES91950.1| 60S ribosomal protein L29 [Medicago truncatula] Length = 445 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE*ICL 163 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKK+ E AS E+ I + Sbjct: 148 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEVASAEDDIVI 201 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKK+ E A+ EE Sbjct: 396 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEEE 445 >ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147811184|emb|CAN63474.1| hypothetical protein VITISV_016797 [Vitis vinifera] gi|297743968|emb|CBI36938.3| unnamed protein product [Vitis vinifera] Length = 62 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP K RH STKGMDPKFLRNQRYARKHNKKS+ +A+ EE Sbjct: 12 QSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNKKSEGSATEEE 61 >ref|XP_006597712.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] Length = 61 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKKS E A+ EE Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGEIATEEE 61 >ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502150865|ref|XP_004508162.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] gi|388515093|gb|AFK45608.1| unknown [Medicago truncatula] Length = 61 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKK+ E A+ EE Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEEE 61 >gb|EPS58528.1| hypothetical protein M569_16287, partial [Genlisea aurea] Length = 60 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVE 148 QS+KAHKNGIKKP + RH ST+GMDPKFLRNQRYARKHNKK++EA S E Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTRGMDPKFLRNQRYARKHNKKNEEAGSQE 60 >ref|XP_002314927.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] gi|550329855|gb|EEF01098.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] Length = 108 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS KAH+NGIKKP + RH STKGMDPKFLRNQRYARKHNKK DE A+ EE Sbjct: 59 QSHKAHQNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCDETATEEE 108 >gb|ABK92573.1| unknown [Populus trichocarpa] gi|118482323|gb|ABK93087.1| unknown [Populus trichocarpa] gi|118483414|gb|ABK93607.1| unknown [Populus trichocarpa] Length = 61 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS KAH+NGIKKP + RH STKGMDPKFLRNQRYARKHNKK DE A+ EE Sbjct: 12 QSHKAHQNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCDETATEEE 61 >ref|XP_006298920.1| hypothetical protein CARUB_v10015053mg [Capsella rubella] gi|482567629|gb|EOA31818.1| hypothetical protein CARUB_v10015053mg [Capsella rubella] Length = 61 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/50 (80%), Positives = 42/50 (84%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS KAHKNGIKKP++ RH STKGMDPKFLRNQRYARKHN K E AS EE Sbjct: 12 QSAKAHKNGIKKPMRHRHTSTKGMDPKFLRNQRYARKHNVKGGEIASAEE 61 >gb|AFK48186.1| unknown [Lotus japonicus] Length = 61 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHNKK E+ + EE Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKGAESVTEEE 61 >ref|XP_006488862.1| PREDICTED: 60S ribosomal protein L29-1-like [Citrus sinensis] Length = 60 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVE 148 QS+KAHKNGIKKP K RH STKGMDPKFLRNQRYARKHNK+ E+A+ E Sbjct: 12 QSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 60 >ref|XP_006419418.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] gi|557521291|gb|ESR32658.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] Length = 88 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVE 148 QS+KAHKNGIKKP K RH STKGMDPKFLRNQRYARKHNK+ E+A+ E Sbjct: 40 QSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 88 >ref|XP_006829382.1| hypothetical protein AMTR_s03807p00002720 [Amborella trichopoda] gi|586684495|ref|XP_006841420.1| hypothetical protein AMTR_s00003p00034600 [Amborella trichopoda] gi|548834679|gb|ERM96798.1| hypothetical protein AMTR_s03807p00002720 [Amborella trichopoda] gi|548843441|gb|ERN03095.1| hypothetical protein AMTR_s00003p00034600 [Amborella trichopoda] Length = 62 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP +QRH STKGMDPKFLRNQRYARKHNK + +A+ EE Sbjct: 12 QSYKAHKNGIKKPRRQRHTSTKGMDPKFLRNQRYARKHNKPNGASATEEE 61 >ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502127331|ref|XP_004499659.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] Length = 61 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +2 Query: 2 QSFKAHKNGIKKPLKQRHQSTKGMDPKFLRNQRYARKHNKKSDEAASVEE 151 QS+KAHKNGIKKP + RH STKGMDPKFLRNQRYARKHN K+ E A+ EE Sbjct: 12 QSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKNGEIATEEE 61