BLASTX nr result
ID: Rheum21_contig00003390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00003390 (753 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297363.1| PREDICTED: uncharacterized protein LOC101298... 66 1e-08 >ref|XP_004297363.1| PREDICTED: uncharacterized protein LOC101298596 [Fragaria vesca subsp. vesca] Length = 141 Score = 66.2 bits (160), Expect = 1e-08 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 3/85 (3%) Frame = +3 Query: 129 STKLAESFQVRCQGSSRSRAPDTVKVARREMALG---LTAVCLTGATGNAEARIVKPEIR 299 +TK A QVR +G S P + V+RR++ L L AV AEARIVKPEIR Sbjct: 29 TTKRALPLQVRSEGRPESCPPKVLGVSRRDVMLPAATLAAVTFFSVEPAAEARIVKPEIR 88 Query: 300 RKIREKLEMLKEMAGLSKQKDDGKK 374 RKI+EKL++L+E AGLS+ K + K Sbjct: 89 RKIQEKLKLLREKAGLSEPKTNQGK 113