BLASTX nr result
ID: Rheum21_contig00003089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00003089 (1141 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 101 5e-19 gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] 76 9e-13 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 72 4e-10 ref|XP_002531736.1| conserved hypothetical protein [Ricinus comm... 53 1e-06 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 101 bits (252), Expect = 5e-19 Identities = 51/58 (87%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = -1 Query: 172 IGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHF*SALVNGSPPY-QERRGSSHGG 2 +GQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHF SALVNGSP QER G SHGG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSPSIKQERSGYSHGG 58 >gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 75.9 bits (185), Expect(2) = 9e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = +2 Query: 23 SFLIGGAPIHQRRLKVLSEPCWIVTHHTALKPNLW*IPGDKV 148 S LI GA IHQRRLKVLSEPCWIVTHHTALKPNLW IP D + Sbjct: 12 SCLIVGASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 Score = 25.4 bits (54), Expect(2) = 9e-13 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 PPWEEPLLS 29 PPWEEPLLS Sbjct: 4 PPWEEPLLS 12 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 72.0 bits (175), Expect = 4e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 172 IGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 71 +GQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002531736.1| conserved hypothetical protein [Ricinus communis] gi|223528639|gb|EEF30656.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 52.8 bits (125), Expect(2) = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -2 Query: 1119 DRGLVVPASAAMQWKGRSLNRPPS 1048 DRGL+VPASAAMQWKGRSLNRPPS Sbjct: 26 DRGLIVPASAAMQWKGRSLNRPPS 49 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 1013 RLDSRMRLSSYRP 975 RLDSRMRLSS+RP Sbjct: 60 RLDSRMRLSSHRP 72